LOCUS CR541979 408 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0235D for gene RBP1, retinol binding protein 1, cellular; complete cds, incl. stopcodon. ACCESSION CR541979 VERSION CR541979.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 408) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 408) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0235D, ORFNo 4191 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0235D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131244.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_002899 (GI:8400726) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..408 /db_xref="H-InvDB:HIT000268848" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0235D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..408 /codon_start=1 /gene="RBP1" /db_xref="GOA:P09455" /db_xref="H-InvDB:HIT000268848.12" /db_xref="HGNC:HGNC:9919" /db_xref="InterPro:IPR000463" /db_xref="InterPro:IPR000566" /db_xref="InterPro:IPR012674" /db_xref="InterPro:IPR031259" /db_xref="InterPro:IPR031264" /db_xref="PDB:5H8T" /db_xref="PDB:5H9A" /db_xref="PDB:5HA1" /db_xref="PDB:5HBS" /db_xref="PDB:5LJB" /db_xref="PDB:5LJC" /db_xref="PDB:5LJD" /db_xref="PDB:5LJE" /db_xref="PDB:5LJG" /db_xref="PDB:5LJH" /db_xref="PDB:5LJK" /db_xref="PDB:6E5L" /db_xref="PDB:6E5T" /db_xref="PDB:6E6M" /db_xref="UniProtKB/Swiss-Prot:P09455" /protein_id="CAG46776.1" /translation="MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIV QDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEK EGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ" BASE COUNT 109 a 82 c 137 g 80 t ORIGIN 1 atgccagtcg acttcactgg gtactggaag atgttggtca acgagaattt cgaggagtac 61 ctgcgcgccc tcgacgtcaa tgtggccttg cgcaaaatcg ccaacttgct gaagccagac 121 aaagagatcg tgcaggacgg tgaccatatg atcatccgca cgctgagcac ttttaggaac 181 tacatcatgg acttccaggt tgggaaggag tttgaggagg atctgacagg catagatgac 241 cgcaagtgca tgacaacagt gagctgggac ggagacaagc tccagtgtgt gcagaagggt 301 gagaaggagg ggcgtggctg gacccagtgg atcgagggtg atgagctgca cctggagatg 361 agagtggaag gtgtggtctg caagcaagta ttcaagaagg tgcagtga //