LOCUS       CR541975                 582 bp    mRNA    linear   HUM 29-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H1234D for
            gene HPCAL1, hippocalcin-like 1; complete cds, incl. stopcodon.
ACCESSION   CR541975
VERSION     CR541975.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 582)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 582)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H1234D, ORFNo 4185
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1234D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131310.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_134421 (GI:19913442)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..582
                     /db_xref="H-InvDB:HIT000268845"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H1234D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..582
                     /codon_start=1
                     /gene="HPCAL1"
                     /db_xref="GOA:Q6FGY1"
                     /db_xref="H-InvDB:HIT000268845.12"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:Q6FGY1"
                     /protein_id="CAG46773.1"
                     /translation="MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLT
                     VDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLK
                     WAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNN
                     DGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF"
BASE COUNT          139 a          180 c          169 g           94 t
ORIGIN      
        1 atgggcaagc agaacagcaa gctgcggccc gaggtgctgc aggacctgcg ggagaacacg
       61 gagttcaccg accacgagct gcaggagtgg tacaagggct tcctcaagga ctgccccacc
      121 ggccacctga ccgtggacga gttcaagaag atctacgcca acttcttccc ctacggcgac
      181 gcttccaagt tcgccgagca cgtcttccgc accttcgaca ccaacggcga cggcaccatc
      241 gacttccggg agttcatcat tgcgctgagc gtgacctcgc ggggcaagct ggagcagaag
      301 ctcaagtggg ccttcagcat gtacgacctg gacggcaacg gctacatcag ccgcagcgag
      361 atgctggaga tcgtgcaggc catctacaag atggtgtcgt ctgtgatgaa gatgccggag
      421 gatgagtcca ccccggagaa gcgcacagac aagatcttca ggcagatgga caccaacaat
      481 gacggcaaac tgtccttgga agaattcatc agaggtgcca agagcgaccc ctccatcgtc
      541 cgcctgctgc agtgcgaccc cagcagcgcc tcccagttct ga
//