LOCUS CR541975 582 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1234D for gene HPCAL1, hippocalcin-like 1; complete cds, incl. stopcodon. ACCESSION CR541975 VERSION CR541975.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 582) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 582) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1234D, ORFNo 4185 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1234D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131310.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_134421 (GI:19913442) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..582 /db_xref="H-InvDB:HIT000268845" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1234D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..582 /codon_start=1 /gene="HPCAL1" /db_xref="GOA:Q6FGY1" /db_xref="H-InvDB:HIT000268845.12" /db_xref="InterPro:IPR002048" /db_xref="InterPro:IPR011992" /db_xref="InterPro:IPR018247" /db_xref="InterPro:IPR028846" /db_xref="UniProtKB/TrEMBL:Q6FGY1" /protein_id="CAG46773.1" /translation="MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLT VDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLK WAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNN DGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF" BASE COUNT 139 a 180 c 169 g 94 t ORIGIN 1 atgggcaagc agaacagcaa gctgcggccc gaggtgctgc aggacctgcg ggagaacacg 61 gagttcaccg accacgagct gcaggagtgg tacaagggct tcctcaagga ctgccccacc 121 ggccacctga ccgtggacga gttcaagaag atctacgcca acttcttccc ctacggcgac 181 gcttccaagt tcgccgagca cgtcttccgc accttcgaca ccaacggcga cggcaccatc 241 gacttccggg agttcatcat tgcgctgagc gtgacctcgc ggggcaagct ggagcagaag 301 ctcaagtggg ccttcagcat gtacgacctg gacggcaacg gctacatcag ccgcagcgag 361 atgctggaga tcgtgcaggc catctacaag atggtgtcgt ctgtgatgaa gatgccggag 421 gatgagtcca ccccggagaa gcgcacagac aagatcttca ggcagatgga caccaacaat 481 gacggcaaac tgtccttgga agaattcatc agaggtgcca agagcgaccc ctccatcgtc 541 cgcctgctgc agtgcgaccc cagcagcgcc tcccagttct ga //