LOCUS       CR541946                1080 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D1134D for
            gene DCN, decorin; complete cds, incl. stopcodon.
ACCESSION   CR541946
VERSION     CR541946.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1080)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1080)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D1134D, ORFNo 4033
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D1134D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_133503 (GI:19743845)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1080
                     /db_xref="H-InvDB:HIT000268816"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D1134D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1080
                     /codon_start=1
                     /gene="DCN"
                     /db_xref="GOA:Q6FH10"
                     /db_xref="H-InvDB:HIT000268816.13"
                     /db_xref="InterPro:IPR000372"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR016352"
                     /db_xref="InterPro:IPR028549"
                     /db_xref="InterPro:IPR032675"
                     /db_xref="UniProtKB/TrEMBL:Q6FH10"
                     /protein_id="CAG46744.1"
                     /translation="MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDR
                     DFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFK
                     NLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHEN
                     EITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQG
                     LPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHL
                     DNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPV
                     QYWEIQPSTFRCVYVRSAIQLGNYK"
BASE COUNT          306 a          267 c          236 g          271 t
ORIGIN      
        1 atgaaggcca ctatcatcct ccttctgctt gcacaagttt cctgggctgg accgtttcaa
       61 cagagaggct tatttgactt tatgctagaa gatgaggctt ctgggatagg cccagaagtt
      121 cctgatgacc gcgacttcga gccctcccta ggcccagtgt gccccttccg ctgtcaatgc
      181 catcttcgag tggtccagtg ttctgatttg ggtctggaca aagtgccaaa ggatcttccc
      241 cctgacacaa ctctgctaga cctgcaaaac aacaaaataa ccgaaatcaa agatggagac
      301 tttaagaacc tgaagaacct tcacgcattg attcttgtca acaataaaat tagcaaagtt
      361 agtcctggag catttacacc tttggtgaag ttggaacgac tttatctgtc caagaatcag
      421 ctgaaggaat tgccagaaaa aatgcccaaa actcttcagg agctgcgtgc ccatgagaat
      481 gagatcacca aagtgcgaaa agttactttc aatggactga accagatgat tgtcatagaa
      541 ctgggcacca atccgctgaa gagctcagga attgaaaatg gggctttcca gggaatgaag
      601 aagctctcct acatccgcat tgctgatacc aatatcacca gcattcctca aggtcttcct
      661 ccttccctta cggaattaca tcttgatggc aacaaaatca gcagagttga tgcagctagc
      721 ctgaaaggac tgaataattt ggctaagttg ggattgagtt tcaacagcat ctctgctgtt
      781 gacaatggct ctctggccaa cacgcctcat ctgagggagc ttcacttgga caacaacaag
      841 cttaccagag tacctggtgg gctggcagag cataagtaca tccaggttgt ctaccttcat
      901 aacaacaata tctctgtagt tggatcaagt gacttctgcc cacctggaca caacaccaaa
      961 aaggcttctt attcgggtgt gagtcttttc agcaacccgg tccagtactg ggagatacag
     1021 ccatccacct tcagatgtgt ctacgtgcgc tctgccattc aactcggaaa ctataagtaa
//