LOCUS       CR541931                 483 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0434D for
            gene PMP22, peripheral myelin protein 22; complete cds, incl.
            stopcodon.
ACCESSION   CR541931
VERSION     CR541931.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 483)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 483)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0434D, ORFNo 3998
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0434D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_000304 (GI:24430161)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..483
                     /db_xref="H-InvDB:HIT000268801"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0434D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..483
                     /codon_start=1
                     /gene="PMP22"
                     /db_xref="GOA:Q6FH25"
                     /db_xref="H-InvDB:HIT000268801.11"
                     /db_xref="InterPro:IPR003936"
                     /db_xref="InterPro:IPR004031"
                     /db_xref="InterPro:IPR004032"
                     /db_xref="UniProtKB/TrEMBL:Q6FH25"
                     /protein_id="CAG46729.1"
                     /translation="MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCST
                     SSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIF
                     QILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAWVAFPLALLSGVIYVILRKRE
                     "
BASE COUNT           87 a          148 c          114 g          134 t
ORIGIN      
        1 atgctcctcc tgttgctgag tatcatcgtc ctccacgtcg cggtgctggt gctgctgttc
       61 gtctccacga tcgtcagcca atggatcgtg ggcaatggac acgcaactga tctctggcag
      121 aactgtagca cctcttcctc aggaaatgtc caccactgtt tctcatcatc accaaacgaa
      181 tggctgcagt ctgtccaggc caccatgatc ctgtcgatca tcttcagcat tctgtctctg
      241 ttcctgttct tctgccaact cttcaccctc accaaggggg gcaggtttta catcactgga
      301 atcttccaaa ttcttgctgg tctgtgcgtg atgagtgctg cggccatcta cacggtgagg
      361 cacccggagt ggcatctcaa ctcggattac tcctacggtt tcgcctacat cctggcctgg
      421 gtggccttcc ccctggccct tctcagcggt gtcatctatg tgatcttgcg gaaacgcgaa
      481 tga
//