LOCUS       CR541904                 744 bp    mRNA    linear   HUM 17-APR-2005
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0133D for
            gene YWHAG, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
            activation protein, gamma polypeptide; complete cds, incl.
            stopcodon.
ACCESSION   CR541904
VERSION     CR541904.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 744)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 744)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0133D, ORFNo 3910
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0133D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130839.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC020963
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..744
                     /db_xref="H-InvDB:HIT000268774"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0133D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..744
                     /codon_start=1
                     /gene="YWHAG"
                     /db_xref="GOA:P61981"
                     /db_xref="H-InvDB:HIT000268774.12"
                     /db_xref="HGNC:HGNC:12852"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="InterPro:IPR036815"
                     /db_xref="PDB:2B05"
                     /db_xref="PDB:3UZD"
                     /db_xref="PDB:4E2E"
                     /db_xref="PDB:4J6S"
                     /db_xref="PDB:4O46"
                     /db_xref="PDB:5D3E"
                     /db_xref="PDB:6A5S"
                     /db_xref="PDB:6BYJ"
                     /db_xref="PDB:6BYL"
                     /db_xref="PDB:6BZD"
                     /db_xref="PDB:6FEL"
                     /db_xref="PDB:6GKF"
                     /db_xref="PDB:6GKG"
                     /db_xref="UniProtKB/Swiss-Prot:P61981"
                     /protein_id="CAG46702.1"
                     /translation="MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNL
                     LSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLS
                     LLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEI
                     SKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKD
                     STLIMQLLRDNLTLWTSDQQDDDGGEGNN"
BASE COUNT          199 a          204 c          222 g          119 t
ORIGIN      
        1 atggtggacc gcgagcaact ggtgcagaaa gcccggctgg ccgagcaggc ggagcgctac
       61 gacgacatgg ccgcggccat gaagaacgtg acagagctga atgagccact gtcgaatgag
      121 gaacgaaacc ttctgtctgt ggcctacaag aacgttgtgg gggcacgccg ctcttcctgg
      181 agggtcatca gtagcattga gcagaagaca tctgcagacg gcaatgagaa gaagattgag
      241 atggtccgtg cgtaccggga gaagatagag aaggagttgg aggctgtgtg ccaggatgtg
      301 ctgagcctgc tggataacta cctgatcaag aattgcagcg agacccagta cgagagcaaa
      361 gtgttctacc tgaagatgaa aggggactac taccgctacc tggctgaagt ggccaccgga
      421 gagaaaaggg cgacggtggt ggagtcctct gagaaggcct acagcgaagc ccacgagatc
      481 agcaaagagc acatgcagcc cacccacccc atccgattag gcctggctct taactactcc
      541 gtcttctact atgagatcca gaacgcccca gagcaagcgt gccacttggc caagaccgcg
      601 ttcgacgacg ccatcgccga gcttgacacc ctcaacgagg actcctacaa ggactccacg
      661 ctcatcatgc agctcctccg cgacaacctc acgctctgga cgagcgacca gcaggacgac
      721 gatggcggcg aaggcaacaa ttaa
//