LOCUS CR541904 744 bp mRNA linear HUM 17-APR-2005 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0133D for gene YWHAG, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; complete cds, incl. stopcodon. ACCESSION CR541904 VERSION CR541904.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 744) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 744) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0133D, ORFNo 3910 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0133D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130839.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BC020963 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..744 /db_xref="H-InvDB:HIT000268774" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0133D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..744 /codon_start=1 /gene="YWHAG" /db_xref="GOA:P61981" /db_xref="H-InvDB:HIT000268774.12" /db_xref="HGNC:HGNC:12852" /db_xref="InterPro:IPR000308" /db_xref="InterPro:IPR023409" /db_xref="InterPro:IPR023410" /db_xref="InterPro:IPR036815" /db_xref="PDB:2B05" /db_xref="PDB:3UZD" /db_xref="PDB:4E2E" /db_xref="PDB:4J6S" /db_xref="PDB:4O46" /db_xref="PDB:5D3E" /db_xref="PDB:6A5S" /db_xref="PDB:6BYJ" /db_xref="PDB:6BYL" /db_xref="PDB:6BZD" /db_xref="PDB:6FEL" /db_xref="PDB:6GKF" /db_xref="PDB:6GKG" /db_xref="UniProtKB/Swiss-Prot:P61981" /protein_id="CAG46702.1" /translation="MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNL LSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLS LLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEI SKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKD STLIMQLLRDNLTLWTSDQQDDDGGEGNN" BASE COUNT 199 a 204 c 222 g 119 t ORIGIN 1 atggtggacc gcgagcaact ggtgcagaaa gcccggctgg ccgagcaggc ggagcgctac 61 gacgacatgg ccgcggccat gaagaacgtg acagagctga atgagccact gtcgaatgag 121 gaacgaaacc ttctgtctgt ggcctacaag aacgttgtgg gggcacgccg ctcttcctgg 181 agggtcatca gtagcattga gcagaagaca tctgcagacg gcaatgagaa gaagattgag 241 atggtccgtg cgtaccggga gaagatagag aaggagttgg aggctgtgtg ccaggatgtg 301 ctgagcctgc tggataacta cctgatcaag aattgcagcg agacccagta cgagagcaaa 361 gtgttctacc tgaagatgaa aggggactac taccgctacc tggctgaagt ggccaccgga 421 gagaaaaggg cgacggtggt ggagtcctct gagaaggcct acagcgaagc ccacgagatc 481 agcaaagagc acatgcagcc cacccacccc atccgattag gcctggctct taactactcc 541 gtcttctact atgagatcca gaacgcccca gagcaagcgt gccacttggc caagaccgcg 601 ttcgacgacg ccatcgccga gcttgacacc ctcaacgagg actcctacaa ggactccacg 661 ctcatcatgc agctcctccg cgacaacctc acgctctgga cgagcgacca gcaggacgac 721 gatggcggcg aaggcaacaa ttaa //