LOCUS CR541896 501 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B1033D for gene TXN2, thioredoxin 2; complete cds, incl. stopcodon. ACCESSION CR541896 VERSION CR541896.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 501) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 501) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B1033D, ORFNo 3887 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B1033D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130874.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_012473 (GI:27436899) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..501 /db_xref="H-InvDB:HIT000268766" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B1033D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..501 /codon_start=1 /gene="TXN2" /db_xref="GOA:Q99757" /db_xref="H-InvDB:HIT000268766.12" /db_xref="HGNC:HGNC:17772" /db_xref="InterPro:IPR005746" /db_xref="InterPro:IPR013766" /db_xref="InterPro:IPR017937" /db_xref="InterPro:IPR036249" /db_xref="PDB:1UVZ" /db_xref="PDB:1W4V" /db_xref="PDB:1W89" /db_xref="UniProtKB/Swiss-Prot:Q99757" /protein_id="CAG46694.1" /translation="MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTV TPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEK MVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAF LKKLIG" BASE COUNT 118 a 129 c 149 g 105 t ORIGIN 1 atggctcagc gacttcttct gaggaggttc ctggcctctg tcatctccag gaagccctct 61 cagggtcagt ggccacccct cacttccaga gccctgcaga ccccacaatg cagtcctggt 121 ggcctgactg taacacccaa cccagcccgg acaatataca ccacgaggat ctccttgaca 181 acctttaata tccaggatgg acctgacttt caagaccgag tggtcaacag tgagacacca 241 gtggttgtgg atttccacgc acagtggtgt ggaccctgca agatcctggg gccgaggtta 301 gagaagatgg tggccaagca gcacgggaag gtggtgatgg ccaaggtgga tattgatgac 361 cacacagacc tcgccattga gtatgaggtg tcagcggtgc ccactgtgct ggccatgaag 421 aatggggacg tggtggacaa gtttgtgggc atcaaggatg aggatcagtt ggaggccttc 481 ctgaagaagc tgattggctg a //