LOCUS       CR541888                 543 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0633D for
            gene CD160, CD160 antigen; complete cds, without stopcodon.
ACCESSION   CR541888
VERSION     CR541888.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 543)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 543)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0633D, ORFNo 3869
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0633D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130859.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_007053 (GI:5901909)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..543
                     /db_xref="H-InvDB:HIT000268758"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0633D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>543
                     /codon_start=1
                     /gene="CD160"
                     /db_xref="GOA:Q6FH89"
                     /db_xref="H-InvDB:HIT000268758.12"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="InterPro:IPR042385"
                     /db_xref="UniProtKB/TrEMBL:Q6FH89"
                     /protein_id="CAG46686.1"
                     /translation="MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLIC
                     TVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQV
                     TPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSS
                     GFLQEKVWVMLVTSLVALQAL"
BASE COUNT          144 a          123 c          141 g          135 t
ORIGIN      
        1 atgctgttgg aacccggcag aggctgctgt gccctggcca tcctgctggc aattgtggac
       61 atccagtctg gtggatgcat taacatcacc agctcagctt cccaggaagg aacgcgacta
      121 aacttaatct gtactgtatg gcataagaaa gaagaggctg aggggtttgt agtgtttttg
      181 tgcaaggaca ggtctggaga ctgttctcct gagaccagtt taaaacagct gagacttaaa
      241 agggatcctg ggatagatgg tgttggtgaa atatcatctc agttgatgtt caccataagc
      301 caagtcacac cgttgcacag tgggacctac cagtgttgtg ccagaagcca gaagtcaggt
      361 atccgccttc agggccattt tttctccatt ctattcacag agacagggaa ctacacagtg
      421 acgggattga aacaaagaca acaccttgag ttcagccata atgaaggcac tctcagttca
      481 ggcttcctac aagaaaaggt ctgggtaatg ctggtcacca gccttgtggc ccttcaagct
      541 ttg
//