LOCUS CR541888 543 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0633D for gene CD160, CD160 antigen; complete cds, without stopcodon. ACCESSION CR541888 VERSION CR541888.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 543) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 543) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0633D, ORFNo 3869 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0633D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130859.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_007053 (GI:5901909) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..543 /db_xref="H-InvDB:HIT000268758" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0633D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>543 /codon_start=1 /gene="CD160" /db_xref="GOA:Q6FH89" /db_xref="H-InvDB:HIT000268758.12" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR036179" /db_xref="InterPro:IPR042385" /db_xref="UniProtKB/TrEMBL:Q6FH89" /protein_id="CAG46686.1" /translation="MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLIC TVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQV TPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSS GFLQEKVWVMLVTSLVALQAL" BASE COUNT 144 a 123 c 141 g 135 t ORIGIN 1 atgctgttgg aacccggcag aggctgctgt gccctggcca tcctgctggc aattgtggac 61 atccagtctg gtggatgcat taacatcacc agctcagctt cccaggaagg aacgcgacta 121 aacttaatct gtactgtatg gcataagaaa gaagaggctg aggggtttgt agtgtttttg 181 tgcaaggaca ggtctggaga ctgttctcct gagaccagtt taaaacagct gagacttaaa 241 agggatcctg ggatagatgg tgttggtgaa atatcatctc agttgatgtt caccataagc 301 caagtcacac cgttgcacag tgggacctac cagtgttgtg ccagaagcca gaagtcaggt 361 atccgccttc agggccattt tttctccatt ctattcacag agacagggaa ctacacagtg 421 acgggattga aacaaagaca acaccttgag ttcagccata atgaaggcac tctcagttca 481 ggcttcctac aagaaaaggt ctgggtaatg ctggtcacca gccttgtggc ccttcaagct 541 ttg //