LOCUS CR541886 507 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0633D for gene MDS1, myelodysplasia syndrome 1; complete cds, without stopcodon. ACCESSION CR541886 VERSION CR541886.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 507) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 507) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0633D, ORFNo 3866 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0633D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130857.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_004991 (GI:4826827) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..507 /db_xref="H-InvDB:HIT000268756" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0633D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>507 /codon_start=1 /gene="MDS1" /db_xref="GOA:Q03112" /db_xref="H-InvDB:HIT000268756.11" /db_xref="HGNC:HGNC:3498" /db_xref="InterPro:IPR001214" /db_xref="InterPro:IPR013087" /db_xref="InterPro:IPR036236" /db_xref="PDB:6BW3" /db_xref="UniProtKB/Swiss-Prot:Q03112" /protein_id="CAG46684.1" /translation="MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQ EPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEV GEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYM PGLQCAFLS" BASE COUNT 142 a 118 c 130 g 117 t ORIGIN 1 atgagatcca aaggcagggc aaggaaactg gccacaaata atgagtgtgt atatggcaac 61 taccctgaaa tacctttgga agaaatgcca gatgcagatg gagtagccag cactccctcc 121 ctcaatattc aagagccatg ctctcctgcc acatccagtg aagcattcac tccaaaggag 181 ggttctcctt acaaagcccc catctacatc cctgatgata tccccattcc tgctgagttt 241 gaacttcgag agtcaaatat gcctggggca ggactaggaa tatggaccaa aaggaagatc 301 gaagtaggtg aaaagtttgg gccttatgtg ggagagcaga ggtcaaacct gaaagacccc 361 agttatggat gggaggtaca tcttccaagg tctcggaggg taagcgttca ctcttggttg 421 tatttgggga agagaagctc agacgtagga atagccttct ctcaggctga tgtctacatg 481 cctggactgc agtgtgcctt cctctcg //