LOCUS       CR541863                 483 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G0832D for
            gene BIK, BCL2-interacting killer (apoptosis-inducing); complete
            cds, incl. stopcodon.
ACCESSION   CR541863
VERSION     CR541863.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 483)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 483)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G0832D, ORFNo 3821
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0832D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130918.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_001197 (GI:21536418)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..483
                     /db_xref="H-InvDB:HIT000268733"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G0832D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..483
                     /codon_start=1
                     /gene="BIK"
                     /db_xref="GOA:Q13323"
                     /db_xref="H-InvDB:HIT000268733.13"
                     /db_xref="HGNC:HGNC:1051"
                     /db_xref="InterPro:IPR020728"
                     /db_xref="InterPro:IPR024579"
                     /db_xref="PDB:2IPE"
                     /db_xref="UniProtKB/Swiss-Prot:Q13323"
                     /protein_id="CAG46661.1"
                     /translation="MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMED
                     FDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD
                     VLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
                     "
BASE COUNT           91 a          137 c          150 g          105 t
ORIGIN      
        1 atgtctgaag taagacccct ctccagagac atcttgatgg agaccctcct gtatgagcag
       61 ctcctggaac ccccgaccat ggaggttctt ggcatgactg actctgaaga ggacctggac
      121 cctatggagg acttcgattc tttggaatgc atggagggca gtgacgcatt ggccctgcgg
      181 ctggcctgca tcggggacga gatggacgtg agcctcaggg ccccgcgcct ggcccagctc
      241 tccgaggtgg ccatgcacag cctgggtctg gctttcatct acgaccagac tgaggacatc
      301 agggatgttc ttagaagttt catggacggt ttcaccacac ttaaggagaa cataatgagg
      361 ttctggagat ccccgaaccc cgggtcctgg gtgtcctgcg aacaggtgct gctggcgctg
      421 ctgctgctgc tggcgctgct gctgccgctg ctcagcgggg gcctgcacct gctgctcaag
      481 tga
//