LOCUS CR541863 483 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0832D for gene BIK, BCL2-interacting killer (apoptosis-inducing); complete cds, incl. stopcodon. ACCESSION CR541863 VERSION CR541863.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 483) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 483) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0832D, ORFNo 3821 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0832D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130918.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_001197 (GI:21536418) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..483 /db_xref="H-InvDB:HIT000268733" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0832D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..483 /codon_start=1 /gene="BIK" /db_xref="GOA:Q13323" /db_xref="H-InvDB:HIT000268733.13" /db_xref="HGNC:HGNC:1051" /db_xref="InterPro:IPR020728" /db_xref="InterPro:IPR024579" /db_xref="PDB:2IPE" /db_xref="UniProtKB/Swiss-Prot:Q13323" /protein_id="CAG46661.1" /translation="MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMED FDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD VLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK " BASE COUNT 91 a 137 c 150 g 105 t ORIGIN 1 atgtctgaag taagacccct ctccagagac atcttgatgg agaccctcct gtatgagcag 61 ctcctggaac ccccgaccat ggaggttctt ggcatgactg actctgaaga ggacctggac 121 cctatggagg acttcgattc tttggaatgc atggagggca gtgacgcatt ggccctgcgg 181 ctggcctgca tcggggacga gatggacgtg agcctcaggg ccccgcgcct ggcccagctc 241 tccgaggtgg ccatgcacag cctgggtctg gctttcatct acgaccagac tgaggacatc 301 agggatgttc ttagaagttt catggacggt ttcaccacac ttaaggagaa cataatgagg 361 ttctggagat ccccgaaccc cgggtcctgg gtgtcctgcg aacaggtgct gctggcgctg 421 ctgctgctgc tggcgctgct gctgccgctg ctcagcgggg gcctgcacct gctgctcaag 481 tga //