LOCUS       CR541849                 990 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0232D for
            gene GRAP2, GRB2-related adaptor protein 2; complete cds, without
            stopcodon.
ACCESSION   CR541849
VERSION     CR541849.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 990)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 990)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0232D, ORFNo 3794
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0232D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130889.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_004810 (GI:19913386)
            we found AA exchange(s) at position (first base of changed
            triplet):
            586(gln->arg)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..990
                     /db_xref="H-InvDB:HIT000268719"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0232D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>990
                     /codon_start=1
                     /gene="GRAP2"
                     /db_xref="H-InvDB:HIT000268719.13"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR035646"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="InterPro:IPR036860"
                     /db_xref="UniProtKB/TrEMBL:Q6FHA6"
                     /protein_id="CAG46647.1"
                     /translation="MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEG
                     YVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDV
                     QHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSL
                     DRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLRQHQHQPQPPQYAPAPQQLQQPP
                     QQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWA
                     RALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR"
BASE COUNT          243 a          281 c          280 g          186 t
ORIGIN      
        1 atggaagctg ttgccaagtt tgatttcact gcttcaggtg aggatgaact gagctttcac
       61 actggagatg ttttgaagat tttaagtaac caagaggagt ggtttaaggc ggagcttggg
      121 agccaggaag gatatgtgcc caagaatttc atagacatcc agtttcccaa atggtttcac
      181 gaaggcctct ctcgacacca ggcagagaac ttactcatgg gcaaggaggt tggcttcttc
      241 atcatccggg ccagccagag ctccccaggg gacttctcca tctctgtcag gcatgaggat
      301 gacgttcaac acttcaaggt catgcgagac aacaagggta attactttct gtggactgag
      361 aagtttccat ccctaaataa gctggtagac tactacagga caaattccat ctccagacag
      421 aagcagatct tccttagaga cagaacccga gaagaccagg gtcaccgggg caacagcctg
      481 gaccggaggt cccagggagg cccacacctc agtggggctg tgggagaaga aatccgacct
      541 tcgatgaacc ggaagctgtc ggatcacccc ccgacccttc ccctgcggca gcaccagcac
      601 cagccacagc ctccgcaata tgccccagcg ccccagcagc tgcagcagcc cccacagcag
      661 cgatatctgc agcaccacca tttccaccag gaacgccgag gaggcagcct tgacataaat
      721 gatgggcatt gtggcaccgg cttgggcagt gaaatgaatg cggccctcat gcatcggaga
      781 cacacagacc cagtgcagct ccaggcggca gggcgagtgc ggtgggcccg ggcgctgtat
      841 gactttgagg ccctggagga tgacgagctg gggttccaca gcggggaggt ggtggaggtc
      901 ctggatagct ccaacccatc ctggtggacc ggccgcctgc acaacaagct gggcctcttc
      961 cctgccaact acgtggcacc catgacccga
//