LOCUS       CR541845                 843 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0132D for
            gene MAPRE3, microtubule-associated protein, RP/EB family, member
            3; complete cds, without stopcodon.
ACCESSION   CR541845
VERSION     CR541845.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 843)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 843)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0132D, ORFNo 3787
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0132D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130883.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_012326 (GI:10800411)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..843
                     /db_xref="H-InvDB:HIT000268715"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0132D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>843
                     /codon_start=1
                     /gene="MAPRE3"
                     /db_xref="GOA:Q9UPY8"
                     /db_xref="H-InvDB:HIT000268715.12"
                     /db_xref="HGNC:HGNC:6892"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR004953"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="InterPro:IPR027738"
                     /db_xref="InterPro:IPR036133"
                     /db_xref="InterPro:IPR036872"
                     /db_xref="InterPro:IPR042180"
                     /db_xref="PDB:1WYO"
                     /db_xref="PDB:3CO1"
                     /db_xref="PDB:3JAK"
                     /db_xref="PDB:3JAL"
                     /db_xref="PDB:3JAR"
                     /db_xref="PDB:3TQ7"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UPY8"
                     /protein_id="CAG46643.1"
                     /translation="MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAY
                     CQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQ
                     DNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQR
                     TSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDG
                     LEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQE
                     DQDEY"
BASE COUNT          247 a          216 c          200 g          180 t
ORIGIN      
        1 atggccgtca atgtgtactc cacatctgtg accagtgaaa atctgagtcg ccatgatatg
       61 cttgcatggg tcaacgactc cctgcacctc aactatacca agatagaaca gctttgttca
      121 ggggcagcct actgccagtt catggacatg ctcttccccg gctgtgtgca cttgaggaaa
      181 gtgaagttcc aggccaaact agagcatgaa tacatccaca acttcaaggt gctgcaagca
      241 gctttcaaga agatgggtgt tgacaaaatc attcctgtag agaaattagt gaaaggaaaa
      301 ttccaagata attttgagtt tattcagtgg tttaagaaat tctttgacgc aaactatgat
      361 ggaaaggatt acaaccctct gctggcgcgg cagggccagg acgtagcgcc acctcctaac
      421 ccaggtgatc agatcttcaa caaatccaag aaactcattg gcacagcagt tccacagagg
      481 acgtccccca caggcccaaa aaacatgcag acctctggcc ggctgagcaa tgtggccccc
      541 ccctgcattc tccggaagaa tcctccatca gcccgaaatg gcggccatga gactgatgcc
      601 caaattcttg aactcaacca acagctggtg gacttgaagc tgacagtgga tgggctggag
      661 aaggaacgtg acttctactt cagcaaactt cgtgacatcg agctcatctg ccaggagcat
      721 gaaagtgaaa acagccctgt tatctcaggc atcattggca tcctctatgc cacagaggaa
      781 ggattcgcac cccctgagga cgatgagatt gaagagcatc aacaagaaga ccaggacgag
      841 tac
//