LOCUS CR541839 948 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A1032D for gene HMOX2, heme oxygenase (decycling) 2; complete cds, without stopcodon. ACCESSION CR541839 VERSION CR541839.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 948) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 948) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A1032D, ORFNo 3774 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1032D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130928.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_002134 (GI:8051607) we found AA exchange(s) at position (first base of changed triplet): 700(phe->tyr) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..948 /db_xref="H-InvDB:HIT000268710" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A1032D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>948 /codon_start=1 /gene="HMOX2" /db_xref="GOA:Q6FHB5" /db_xref="H-InvDB:HIT000268710.12" /db_xref="InterPro:IPR002051" /db_xref="InterPro:IPR016053" /db_xref="InterPro:IPR016084" /db_xref="InterPro:IPR018207" /db_xref="UniProtKB/TrEMBL:Q6FHB5" /protein_id="CAG46638.1" /translation="MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEA HDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPME LHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGD LSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKER IVEEANKAFEYNMQIYNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGA LEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM" BASE COUNT 257 a 242 c 284 g 165 t ORIGIN 1 atgtcagcgg aagtggaaac ctcagagggg gtagacgagt cagaaaaaaa gaactctggg 61 gccctagaaa aggagaacca aatgagaatg gctgacctct cggagctcct gaaggaaggg 121 accaaggaag cacacgaccg ggcagaaaac acccagtttg tcaaggactt cttgaaaggc 181 aacattaaga aggagctgtt taagctggcc accacggcac tttacttcac atactcagcc 241 ctcgaggagg aaatggagcg caacaaggac catccagcct ttgccccttt gtacttcccc 301 atggagctgc accggaagga ggcgctgacc aaggacatgg agtatttctt tggtgaaaac 361 tgggaggagc aggtgcagtg ccccaaggct gcccagaagt acgtggagcg gatccactac 421 atagggcaga acgagccgga gctactggtg gcccatgcat acacccgcta catgggggat 481 ctctcggggg gccaggtgct gaagaaggtg gcccagcgag cactgaaact ccccagcaca 541 ggggaaggga cccagttcta cctgtttgag aatgtggaca atgcccagca gttcaagcag 601 ctctaccggg ccaggatgaa cgccctggac ctgaacatga agaccaaaga gaggatcgtg 661 gaggaggcca acaaggcttt tgagtataac atgcagatat acaatgaact ggaccaggcc 721 ggctccacac tggccagaga gaccttggag gatgggttcc ctgtacacga tgggaaagga 781 gacatgcgta aatgcccttt ctacgctgct gaacaagaca aaggtgccct ggagggcagc 841 agctgtccct tccgaacagc tatggctgtg ctgaggaagc ccagcctcca gttcatcctg 901 gccgctggtg tggccctagc tgctggactc ttggcctggt actacatg //