LOCUS       CR541839                 948 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A1032D for
            gene HMOX2, heme oxygenase (decycling) 2; complete cds, without
            stopcodon.
ACCESSION   CR541839
VERSION     CR541839.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 948)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 948)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A1032D, ORFNo 3774
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1032D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130928.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_002134 (GI:8051607)
            we found AA exchange(s) at position (first base of changed
            triplet):
            700(phe->tyr)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..948
                     /db_xref="H-InvDB:HIT000268710"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A1032D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>948
                     /codon_start=1
                     /gene="HMOX2"
                     /db_xref="GOA:Q6FHB5"
                     /db_xref="H-InvDB:HIT000268710.12"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR018207"
                     /db_xref="UniProtKB/TrEMBL:Q6FHB5"
                     /protein_id="CAG46638.1"
                     /translation="MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEA
                     HDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPME
                     LHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGD
                     LSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKER
                     IVEEANKAFEYNMQIYNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGA
                     LEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM"
BASE COUNT          257 a          242 c          284 g          165 t
ORIGIN      
        1 atgtcagcgg aagtggaaac ctcagagggg gtagacgagt cagaaaaaaa gaactctggg
       61 gccctagaaa aggagaacca aatgagaatg gctgacctct cggagctcct gaaggaaggg
      121 accaaggaag cacacgaccg ggcagaaaac acccagtttg tcaaggactt cttgaaaggc
      181 aacattaaga aggagctgtt taagctggcc accacggcac tttacttcac atactcagcc
      241 ctcgaggagg aaatggagcg caacaaggac catccagcct ttgccccttt gtacttcccc
      301 atggagctgc accggaagga ggcgctgacc aaggacatgg agtatttctt tggtgaaaac
      361 tgggaggagc aggtgcagtg ccccaaggct gcccagaagt acgtggagcg gatccactac
      421 atagggcaga acgagccgga gctactggtg gcccatgcat acacccgcta catgggggat
      481 ctctcggggg gccaggtgct gaagaaggtg gcccagcgag cactgaaact ccccagcaca
      541 ggggaaggga cccagttcta cctgtttgag aatgtggaca atgcccagca gttcaagcag
      601 ctctaccggg ccaggatgaa cgccctggac ctgaacatga agaccaaaga gaggatcgtg
      661 gaggaggcca acaaggcttt tgagtataac atgcagatat acaatgaact ggaccaggcc
      721 ggctccacac tggccagaga gaccttggag gatgggttcc ctgtacacga tgggaaagga
      781 gacatgcgta aatgcccttt ctacgctgct gaacaagaca aaggtgccct ggagggcagc
      841 agctgtccct tccgaacagc tatggctgtg ctgaggaagc ccagcctcca gttcatcctg
      901 gccgctggtg tggccctagc tgctggactc ttggcctggt actacatg
//