LOCUS CR541830 810 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0732D for gene VDRIP, vitamin D receptor interacting protein; complete cds, without stopcodon. ACCESSION CR541830 VERSION CR541830.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 810) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 810) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0732D, ORFNo 3761 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0732D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130908.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_014166 (GI:40254874) we found AA exchange(s) at position (first base of changed triplet): 358(ile->thr) 793(ser->thr) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..810 /db_xref="H-InvDB:HIT000268701" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0732D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>810 /codon_start=1 /gene="VDRIP" /db_xref="GOA:Q9NPJ6" /db_xref="H-InvDB:HIT000268701.14" /db_xref="HGNC:HGNC:17903" /db_xref="InterPro:IPR019258" /db_xref="UniProtKB/Swiss-Prot:Q9NPJ6" /protein_id="CAG46629.1" /translation="MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSREL IEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEK RDSDIQQLQKQLKEAEQTLATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNA VCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAP QYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSTSSESD" BASE COUNT 264 a 147 c 217 g 182 t ORIGIN 1 atggctgcgt cttcgagtgg tgagaaggag aaggagcggc tgggaggcgg tttgggagtg 61 gcgggtggta acagcacacg agagcggctg ctgtctgcgc ttgaggactt ggaggtcctg 121 tctagggaac ttatagaaat gctggcaatt tcaagaaacc aaaagttgtt acaggctgga 181 gaggaaaacc aggtcctgga gttgttaatt caccgagatg gggaatttca agaactaatg 241 aaattggcac ttaatcaggg aaaaattcat catgaaatgc aagttttaga aaaagaagta 301 gagaagagag acagtgatat tcagcagcta caaaaacagc taaaggaagc agaacaaaca 361 ctggcaacag ctgtttacca agcgaaggag aaactcaagt caatagaaaa agcaagaaaa 421 ggtgctatct cctctgaaga aataattaag tatgcacata ggatcagtgc aagtaatgct 481 gtatgtgctc cactgacctg ggttccaggg gacccccgga gaccctaccc aactgattta 541 gagatgagaa gtgggttact gggtcagatg aacaatcctt ccactaatgg cgtgaatggc 601 catttaccag gagatgcact tgcagcagga agattgccag atgtccttgc tccacagtat 661 ccatggcagt caaatgacat gtcgatgaat atgttaccac caaatcatag tagtgacttt 721 ttgttggaac ctcctgggca taataaagaa aatgaagatg atgtagagat tatgtcaacg 781 gactcctcaa gcactagtag tgagtctgat //