LOCUS       CR541830                 810 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0732D for
            gene VDRIP, vitamin D receptor interacting protein; complete cds,
            without stopcodon.
ACCESSION   CR541830
VERSION     CR541830.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 810)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 810)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0732D, ORFNo 3761
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0732D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130908.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_014166 (GI:40254874)
            we found AA exchange(s) at position (first base of changed
            triplet):
            358(ile->thr) 793(ser->thr)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..810
                     /db_xref="H-InvDB:HIT000268701"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0732D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>810
                     /codon_start=1
                     /gene="VDRIP"
                     /db_xref="GOA:Q9NPJ6"
                     /db_xref="H-InvDB:HIT000268701.14"
                     /db_xref="HGNC:HGNC:17903"
                     /db_xref="InterPro:IPR019258"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NPJ6"
                     /protein_id="CAG46629.1"
                     /translation="MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSREL
                     IEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEK
                     RDSDIQQLQKQLKEAEQTLATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNA
                     VCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAP
                     QYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSTSSESD"
BASE COUNT          264 a          147 c          217 g          182 t
ORIGIN      
        1 atggctgcgt cttcgagtgg tgagaaggag aaggagcggc tgggaggcgg tttgggagtg
       61 gcgggtggta acagcacacg agagcggctg ctgtctgcgc ttgaggactt ggaggtcctg
      121 tctagggaac ttatagaaat gctggcaatt tcaagaaacc aaaagttgtt acaggctgga
      181 gaggaaaacc aggtcctgga gttgttaatt caccgagatg gggaatttca agaactaatg
      241 aaattggcac ttaatcaggg aaaaattcat catgaaatgc aagttttaga aaaagaagta
      301 gagaagagag acagtgatat tcagcagcta caaaaacagc taaaggaagc agaacaaaca
      361 ctggcaacag ctgtttacca agcgaaggag aaactcaagt caatagaaaa agcaagaaaa
      421 ggtgctatct cctctgaaga aataattaag tatgcacata ggatcagtgc aagtaatgct
      481 gtatgtgctc cactgacctg ggttccaggg gacccccgga gaccctaccc aactgattta
      541 gagatgagaa gtgggttact gggtcagatg aacaatcctt ccactaatgg cgtgaatggc
      601 catttaccag gagatgcact tgcagcagga agattgccag atgtccttgc tccacagtat
      661 ccatggcagt caaatgacat gtcgatgaat atgttaccac caaatcatag tagtgacttt
      721 ttgttggaac ctcctgggca taataaagaa aatgaagatg atgtagagat tatgtcaacg
      781 gactcctcaa gcactagtag tgagtctgat
//