LOCUS CR541823 522 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0332D for gene RBM8A, RNA binding motif protein 8A; complete cds, without stopcodon. ACCESSION CR541823 VERSION CR541823.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 522) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 522) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0332D, ORFNo 3747 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0332D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130891.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005105 (GI:15812217) we found AA exchange(s) at position (first base of changed triplet): 388(ala->val) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..522 /db_xref="H-InvDB:HIT000268694" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0332D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>522 /codon_start=1 /gene="RBM8A" /db_xref="GOA:Q9Y5S9" /db_xref="H-InvDB:HIT000268694.12" /db_xref="HGNC:HGNC:9905" /db_xref="InterPro:IPR000504" /db_xref="InterPro:IPR008111" /db_xref="InterPro:IPR012677" /db_xref="InterPro:IPR033744" /db_xref="InterPro:IPR035979" /db_xref="PDB:1P27" /db_xref="PDB:2HYI" /db_xref="PDB:2J0Q" /db_xref="PDB:2J0S" /db_xref="PDB:2XB2" /db_xref="PDB:3EX7" /db_xref="PDB:5XJC" /db_xref="PDB:5YZG" /db_xref="PDB:6ICZ" /db_xref="PDB:6QDV" /db_xref="UniProtKB/Swiss-Prot:Q9Y5S9" /protein_id="CAG46622.1" /translation="MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEE GSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNI HLNLDRRTGYLKGYTLVEYETYKEAQAVMEGLNGQDLMGQPISVDWCFVRGPPKGKRR GGRRRSRSPDRRRR" BASE COUNT 154 a 107 c 167 g 94 t ORIGIN 1 atggcggacg tgctagatct tcacgaggct gggggcgaag atttcgccat ggatgaggat 61 ggggacgaga gcattcacaa actgaaagaa aaagcgaaga aacggaaggg tcgcggcttt 121 ggctccgaag aggggtcccg agcgcggatg cgtgaggatt atgacagcgt ggagcaggat 181 ggcgatgaac ccggaccaca acgctctgtt gaaggctgga ttctctttgt aactggagtc 241 catgaggaag ccaccgaaga agacatacac gacaaattcg cagaatatgg ggaaattaaa 301 aacattcatc tcaacctcga caggcgaaca ggatatctga aggggtatac tctagttgaa 361 tatgaaacat acaaggaagc ccaggctgtt atggagggac tcaatggcca ggatttgatg 421 ggacagccca tcagcgttga ctggtgtttt gttcggggtc caccaaaagg caagaggaga 481 ggtggccgaa gacgcagcag aagtccagac cggagacgtc gc //