LOCUS       CR541823                 522 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0332D for
            gene RBM8A, RNA binding motif protein 8A; complete cds, without
            stopcodon.
ACCESSION   CR541823
VERSION     CR541823.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 522)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 522)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0332D, ORFNo 3747
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0332D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130891.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_005105 (GI:15812217)
            we found AA exchange(s) at position (first base of changed
            triplet):
            388(ala->val)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..522
                     /db_xref="H-InvDB:HIT000268694"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0332D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>522
                     /codon_start=1
                     /gene="RBM8A"
                     /db_xref="GOA:Q9Y5S9"
                     /db_xref="H-InvDB:HIT000268694.12"
                     /db_xref="HGNC:HGNC:9905"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR008111"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR033744"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="PDB:1P27"
                     /db_xref="PDB:2HYI"
                     /db_xref="PDB:2J0Q"
                     /db_xref="PDB:2J0S"
                     /db_xref="PDB:2XB2"
                     /db_xref="PDB:3EX7"
                     /db_xref="PDB:5XJC"
                     /db_xref="PDB:5YZG"
                     /db_xref="PDB:6ICZ"
                     /db_xref="PDB:6QDV"
                     /db_xref="UniProtKB/Swiss-Prot:Q9Y5S9"
                     /protein_id="CAG46622.1"
                     /translation="MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEE
                     GSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNI
                     HLNLDRRTGYLKGYTLVEYETYKEAQAVMEGLNGQDLMGQPISVDWCFVRGPPKGKRR
                     GGRRRSRSPDRRRR"
BASE COUNT          154 a          107 c          167 g           94 t
ORIGIN      
        1 atggcggacg tgctagatct tcacgaggct gggggcgaag atttcgccat ggatgaggat
       61 ggggacgaga gcattcacaa actgaaagaa aaagcgaaga aacggaaggg tcgcggcttt
      121 ggctccgaag aggggtcccg agcgcggatg cgtgaggatt atgacagcgt ggagcaggat
      181 ggcgatgaac ccggaccaca acgctctgtt gaaggctgga ttctctttgt aactggagtc
      241 catgaggaag ccaccgaaga agacatacac gacaaattcg cagaatatgg ggaaattaaa
      301 aacattcatc tcaacctcga caggcgaaca ggatatctga aggggtatac tctagttgaa
      361 tatgaaacat acaaggaagc ccaggctgtt atggagggac tcaatggcca ggatttgatg
      421 ggacagccca tcagcgttga ctggtgtttt gttcggggtc caccaaaagg caagaggaga
      481 ggtggccgaa gacgcagcag aagtccagac cggagacgtc gc
//