LOCUS       CR541819                 861 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0232D for
            gene CAPZA1, capping protein (actin filament) muscle Z-line, alpha
            1; complete cds, incl. stopcodon.
ACCESSION   CR541819
VERSION     CR541819.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 861)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 861)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0232D, ORFNo 3739
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0232D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130885.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC000144
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..861
                     /db_xref="H-InvDB:HIT000268690"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0232D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..861
                     /codon_start=1
                     /gene="CAPZA1"
                     /db_xref="GOA:P52907"
                     /db_xref="H-InvDB:HIT000268690.13"
                     /db_xref="HGNC:HGNC:1488"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /db_xref="InterPro:IPR037282"
                     /db_xref="InterPro:IPR042276"
                     /db_xref="InterPro:IPR042489"
                     /db_xref="PDB:1MQ1"
                     /db_xref="PDB:1MWN"
                     /db_xref="UniProtKB/Swiss-Prot:P52907"
                     /protein_id="CAG46618.1"
                     /translation="MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDN
                     LLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLR
                     KEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIES
                     HQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTV
                     SNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILS
                     YKIGKEMQNA"
BASE COUNT          281 a          174 c          194 g          212 t
ORIGIN      
        1 atggccgact tcgatgatcg tgtgtcggat gaggagaagg tacgcatagc tgctaaattc
       61 atcactcatg cacccccagg ggaatttaat gaagtattca atgacgttcg gctactactt
      121 aataatgaca atctcctcag ggaaggggca gcacatgcat ttgcccagta taacatggat
      181 cagttcacgc ctgtgaagat agaaggatat gaagatcagg tcttaattac agagcacggt
      241 gacctgggta atagcagatt tttagatcca agaaacaaaa tttcctttaa atttgaccac
      301 ttacggaaag aagcaagtga cccccagcca gaagaagcag atggaggtct gaagtcttgg
      361 agagaatcct gtgacagtgc tttaagagcc tatgtgaaag accattattc caacggcttc
      421 tgtactgttt atgctaaaac tatcgatggg caacagacta ttattgcatg tattgaaagc
      481 caccagtttc agcctaaaaa cttctggaat ggtcgttgga gatcagagtg gaagttcacc
      541 atcacaccac ctacagccca ggtggttggc gtgcttaaga ttcaggttca ctattatgaa
      601 gatggcaatg ttcagttggt tagtcataaa gatgtacagg attcactaac tgtttcgaat
      661 gaagcccaaa ctgccaagga gtttattaaa atcatagaga atgcagaaaa tgagtatcag
      721 acagcaatta gtgaaaacta tcaaacaatg tcagatacca cattcaaggc cttgcgccgg
      781 cagcttccag ttacccgcac caaaatcgac tggaacaaga tactcagcta caagattggc
      841 aaagaaatgc agaatgctta a
//