LOCUS CR541817 996 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0132D for gene IFNAR2, interferon (alpha, beta and omega) receptor 2; complete cds, incl. stopcodon. ACCESSION CR541817 VERSION CR541817.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 996) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 996) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0132D, ORFNo 3737 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0132D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130881.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_000874 (GI:19923128) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..996 /db_xref="H-InvDB:HIT000268688" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0132D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..996 /codon_start=1 /gene="IFNAR2" /db_xref="GOA:P48551" /db_xref="H-InvDB:HIT000268688.12" /db_xref="HGNC:HGNC:5433" /db_xref="InterPro:IPR003961" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR015373" /db_xref="InterPro:IPR036116" /db_xref="PDB:1N6U" /db_xref="PDB:1N6V" /db_xref="PDB:2HYM" /db_xref="PDB:2KZ1" /db_xref="PDB:2LAG" /db_xref="PDB:3S8W" /db_xref="PDB:3S9D" /db_xref="PDB:3SE3" /db_xref="PDB:3SE4" /db_xref="UniProtKB/Swiss-Prot:P48551" /protein_id="CAG46616.1" /translation="MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKIS LRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRST HEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEE ELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQ AVIKSPLKCTLLPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSL PKVLRQGLAKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD" BASE COUNT 303 a 208 c 202 g 283 t ORIGIN 1 atgcttttga gccagaatgc cttcatcttc agatcactta atttggttct catggtgtat 61 atcagcctcg tgtttggtat ttcatatgat tcgcctgatt acacagatga atcttgcact 121 ttcaagatat cattgcgaaa tttccggtcc atcttatcat gggaattaaa aaaccactcc 181 attgtaccaa ctcactatac attgctgtat acaatcatga gtaaaccaga agatttgaag 241 gtggttaaga actgtgcaaa taccacaaga tcattttgtg acctcacaga tgagtggaga 301 agcacacacg aggcctatgt caccgtccta gaaggattca gcgggaacac aacgttgttc 361 agttgctcac acaatttctg gctggccata gacatgtctt ttgaaccacc agagtttgag 421 attgttggtt ttaccaacca cattaatgtg atggtgaaat ttccatctat tgttgaggaa 481 gaattacagt ttgatttatc tctcgtcatt gaagaacagt cagagggaat tgttaagaag 541 cataaacccg aaataaaagg aaacatgagt ggaaatttca cctatatcat tgacaagtta 601 attccaaaca cgaactactg tgtatctgtt tatttagagc acagtgatga gcaagcagta 661 ataaagtctc ccttaaaatg caccctcctt ccacctggcc aggaatcaga atcagcagaa 721 tctgccaaaa taggaggaat aattactgtg tttttgatag cattggtctt gacaagcacc 781 atagtgacac tgaaatggat tggttatata tgcttaagaa atagcctccc caaagtcttg 841 aggcaaggtc tcgctaaggg ctggaatgca gtggctattc acaggtgcag tcataatgca 901 ctacagtctg aaactcctga gctcaaacag tcgtcctgcc taagcttccc cagtagctgg 961 gattacaagc gtgcatccct gtgccccagt gattaa //