LOCUS       CR541817                 996 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0132D for
            gene IFNAR2, interferon (alpha, beta and omega) receptor 2;
            complete cds, incl. stopcodon.
ACCESSION   CR541817
VERSION     CR541817.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 996)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 996)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0132D, ORFNo 3737
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0132D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130881.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_000874 (GI:19923128)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..996
                     /db_xref="H-InvDB:HIT000268688"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0132D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..996
                     /codon_start=1
                     /gene="IFNAR2"
                     /db_xref="GOA:P48551"
                     /db_xref="H-InvDB:HIT000268688.12"
                     /db_xref="HGNC:HGNC:5433"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR015373"
                     /db_xref="InterPro:IPR036116"
                     /db_xref="PDB:1N6U"
                     /db_xref="PDB:1N6V"
                     /db_xref="PDB:2HYM"
                     /db_xref="PDB:2KZ1"
                     /db_xref="PDB:2LAG"
                     /db_xref="PDB:3S8W"
                     /db_xref="PDB:3S9D"
                     /db_xref="PDB:3SE3"
                     /db_xref="PDB:3SE4"
                     /db_xref="UniProtKB/Swiss-Prot:P48551"
                     /protein_id="CAG46616.1"
                     /translation="MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKIS
                     LRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRST
                     HEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEE
                     ELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQ
                     AVIKSPLKCTLLPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSL
                     PKVLRQGLAKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD"
BASE COUNT          303 a          208 c          202 g          283 t
ORIGIN      
        1 atgcttttga gccagaatgc cttcatcttc agatcactta atttggttct catggtgtat
       61 atcagcctcg tgtttggtat ttcatatgat tcgcctgatt acacagatga atcttgcact
      121 ttcaagatat cattgcgaaa tttccggtcc atcttatcat gggaattaaa aaaccactcc
      181 attgtaccaa ctcactatac attgctgtat acaatcatga gtaaaccaga agatttgaag
      241 gtggttaaga actgtgcaaa taccacaaga tcattttgtg acctcacaga tgagtggaga
      301 agcacacacg aggcctatgt caccgtccta gaaggattca gcgggaacac aacgttgttc
      361 agttgctcac acaatttctg gctggccata gacatgtctt ttgaaccacc agagtttgag
      421 attgttggtt ttaccaacca cattaatgtg atggtgaaat ttccatctat tgttgaggaa
      481 gaattacagt ttgatttatc tctcgtcatt gaagaacagt cagagggaat tgttaagaag
      541 cataaacccg aaataaaagg aaacatgagt ggaaatttca cctatatcat tgacaagtta
      601 attccaaaca cgaactactg tgtatctgtt tatttagagc acagtgatga gcaagcagta
      661 ataaagtctc ccttaaaatg caccctcctt ccacctggcc aggaatcaga atcagcagaa
      721 tctgccaaaa taggaggaat aattactgtg tttttgatag cattggtctt gacaagcacc
      781 atagtgacac tgaaatggat tggttatata tgcttaagaa atagcctccc caaagtcttg
      841 aggcaaggtc tcgctaaggg ctggaatgca gtggctattc acaggtgcag tcataatgca
      901 ctacagtctg aaactcctga gctcaaacag tcgtcctgcc taagcttccc cagtagctgg
      961 gattacaagc gtgcatccct gtgccccagt gattaa
//