LOCUS CR541809 807 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0731D for gene TM4SF9, transmembrane 4 superfamily member 9; complete cds, incl. stopcodon. ACCESSION CR541809 VERSION CR541809.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 807) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 807) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0731D, ORFNo 3711 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0731D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130951.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005723 (GI:21264582) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..807 /db_xref="H-InvDB:HIT000268680" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0731D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..807 /codon_start=1 /gene="TM4SF9" /db_xref="GOA:P62079" /db_xref="H-InvDB:HIT000268680.12" /db_xref="HGNC:HGNC:17753" /db_xref="InterPro:IPR000301" /db_xref="InterPro:IPR008952" /db_xref="InterPro:IPR018499" /db_xref="InterPro:IPR018503" /db_xref="UniProtKB/Swiss-Prot:P62079" /protein_id="CAG46608.1" /translation="MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEK GVLSNISSITDLGGFDPVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIF FLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGAD DWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYT KGCVPQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW" BASE COUNT 202 a 161 c 199 g 245 t ORIGIN 1 atgtccggga agcactacaa gggtcctgaa gtcagttgtt gcatcaaata cttcatattt 61 ggcttcaatg tcatattttg gtttttggga ataacatttc ttggaattgg actgtgggca 121 tggaatgaaa aaggagttct gtccaacatc tcttccatca ccgatctcgg cggctttgac 181 ccagtttggc tcttccttgt ggtgggagga gtgatgttca ttttgggatt tgcagggtgc 241 attggagcgc tacgggaaaa cactttcctt ctcaagtttt tttctgtgtt cctgggaatt 301 attttcttcc tggagctcac tgccggagtt ctagcatttg ttttcaaaga ctggatcaaa 361 gaccagctgt atttctttat aaacaacaac atcagagcat atcgggatga cattgatttg 421 caaaacctca tagacttcac ccaggaatat tggcagtgct gtggggcttt tggagctgat 481 gattggaacc taaatattta cttcaattgc acagattcca atgcaagtcg agagcgatgt 541 ggcgttccat tctcctgctg cactaaagat cccgcagaag atgtcatcaa cactcagtgt 601 ggctatgatg ccaggcaaaa accagaagtt gaccagcaga ttgtaatcta cacgaaaggc 661 tgtgtgcccc agtttgagaa gtggttgcag gacaatttaa ccatcgttgc tggtattttc 721 ataggcattg cattgctgca gatatttggg atatgcctgg cccagaattt ggttagcgat 781 atcgaagctg tcagggcgag ctggtag //