LOCUS       CR541809                 807 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0731D for
            gene TM4SF9, transmembrane 4 superfamily member 9; complete cds,
            incl. stopcodon.
ACCESSION   CR541809
VERSION     CR541809.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 807)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 807)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0731D, ORFNo 3711
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0731D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130951.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_005723 (GI:21264582)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..807
                     /db_xref="H-InvDB:HIT000268680"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0731D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..807
                     /codon_start=1
                     /gene="TM4SF9"
                     /db_xref="GOA:P62079"
                     /db_xref="H-InvDB:HIT000268680.12"
                     /db_xref="HGNC:HGNC:17753"
                     /db_xref="InterPro:IPR000301"
                     /db_xref="InterPro:IPR008952"
                     /db_xref="InterPro:IPR018499"
                     /db_xref="InterPro:IPR018503"
                     /db_xref="UniProtKB/Swiss-Prot:P62079"
                     /protein_id="CAG46608.1"
                     /translation="MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEK
                     GVLSNISSITDLGGFDPVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIF
                     FLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGAD
                     DWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYT
                     KGCVPQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW"
BASE COUNT          202 a          161 c          199 g          245 t
ORIGIN      
        1 atgtccggga agcactacaa gggtcctgaa gtcagttgtt gcatcaaata cttcatattt
       61 ggcttcaatg tcatattttg gtttttggga ataacatttc ttggaattgg actgtgggca
      121 tggaatgaaa aaggagttct gtccaacatc tcttccatca ccgatctcgg cggctttgac
      181 ccagtttggc tcttccttgt ggtgggagga gtgatgttca ttttgggatt tgcagggtgc
      241 attggagcgc tacgggaaaa cactttcctt ctcaagtttt tttctgtgtt cctgggaatt
      301 attttcttcc tggagctcac tgccggagtt ctagcatttg ttttcaaaga ctggatcaaa
      361 gaccagctgt atttctttat aaacaacaac atcagagcat atcgggatga cattgatttg
      421 caaaacctca tagacttcac ccaggaatat tggcagtgct gtggggcttt tggagctgat
      481 gattggaacc taaatattta cttcaattgc acagattcca atgcaagtcg agagcgatgt
      541 ggcgttccat tctcctgctg cactaaagat cccgcagaag atgtcatcaa cactcagtgt
      601 ggctatgatg ccaggcaaaa accagaagtt gaccagcaga ttgtaatcta cacgaaaggc
      661 tgtgtgcccc agtttgagaa gtggttgcag gacaatttaa ccatcgttgc tggtattttc
      721 ataggcattg cattgctgca gatatttggg atatgcctgg cccagaattt ggttagcgat
      781 atcgaagctg tcagggcgag ctggtag
//