LOCUS       CR541766                 939 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0430D for
            gene CA4, carbonic anhydrase IV; complete cds, incl. stopcodon.
ACCESSION   CR541766
VERSION     CR541766.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 939)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 939)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0430D, ORFNo 3529
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0430D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131003.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_000717 (GI:9951925)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..939
                     /db_xref="H-InvDB:HIT000268637"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0430D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..939
                     /codon_start=1
                     /gene="CA4"
                     /db_xref="GOA:P22748"
                     /db_xref="H-InvDB:HIT000268637.12"
                     /db_xref="HGNC:HGNC:1375"
                     /db_xref="InterPro:IPR001148"
                     /db_xref="InterPro:IPR018338"
                     /db_xref="InterPro:IPR018343"
                     /db_xref="InterPro:IPR023561"
                     /db_xref="InterPro:IPR036398"
                     /db_xref="InterPro:IPR041874"
                     /db_xref="PDB:1ZNC"
                     /db_xref="PDB:3F7B"
                     /db_xref="PDB:3F7U"
                     /db_xref="PDB:3FW3"
                     /db_xref="PDB:5IPZ"
                     /db_xref="PDB:5JN8"
                     /db_xref="PDB:5JN9"
                     /db_xref="PDB:5JNA"
                     /db_xref="PDB:5JNC"
                     /db_xref="PDB:5KU6"
                     /db_xref="UniProtKB/Swiss-Prot:P22748"
                     /protein_id="CAG46565.1"
                     /translation="MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGG
                     NCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISG
                     GGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPE
                     DEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYF
                     RYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQL
                     GQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR"
BASE COUNT          220 a          271 c          279 g          169 t
ORIGIN      
        1 atgcggatgc tgctggcgct cctggccctc tccgcggcgc ggccatcggc cagtgcagag
       61 tcacactggt gctacgaggt tcaagccgag tcctccaact acccctgctt ggtgccagtc
      121 aagtggggtg gaaactgcca gaaggaccgc cagtccccca tcaacatcgt caccaccaag
      181 gcaaaggtgg acaaaaaact gggacgcttc ttcttctctg gctacgataa gaagcaaacg
      241 tggactgtcc aaaataacgg gcactcagtg atgatgttgc tggagaacaa ggccagcatt
      301 tctggaggag gactgcctgc cccataccag gccaaacagt tgcacctgca ctggtccgac
      361 ttgccatata agggctcgga gcacagcctc gatggggagc actttgccat ggagatgcac
      421 atagtacatg agaaagagaa ggggacatcg aggaatgtga aagaggccca ggaccctgaa
      481 gacgaaattg cggtgctggc ctttctggtg gaggctggaa cccaggtgaa cgagggcttc
      541 cagccactgg tggaggcact gtctaatatc cccaaacctg agatgagcac tacgatggca
      601 gagagcagcc tgttggacct gctccccaag gaggagaaac tgaggcacta cttccgctac
      661 ctgggctcac tcaccacacc gacctgcgat gagaaggtcg tctggactgt gttccgggag
      721 cccattcagc ttcacagaga acagatcctg gcattctctc agaagctgta ctacgacaag
      781 gaacagacag tgagcatgaa ggacaatgtc aggcccctgc agcagctggg gcagcgcacg
      841 gtgataaagt ccggggcccc gggtcggccg ctgccctggg ccctgcctgc cctgctgggc
      901 cccatgctgg cctgcctgct ggccggcttc ctgcgatga
//