LOCUS CR541766 939 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0430D for gene CA4, carbonic anhydrase IV; complete cds, incl. stopcodon. ACCESSION CR541766 VERSION CR541766.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 939) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 939) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0430D, ORFNo 3529 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0430D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131003.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_000717 (GI:9951925) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..939 /db_xref="H-InvDB:HIT000268637" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0430D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..939 /codon_start=1 /gene="CA4" /db_xref="GOA:P22748" /db_xref="H-InvDB:HIT000268637.12" /db_xref="HGNC:HGNC:1375" /db_xref="InterPro:IPR001148" /db_xref="InterPro:IPR018338" /db_xref="InterPro:IPR018343" /db_xref="InterPro:IPR023561" /db_xref="InterPro:IPR036398" /db_xref="InterPro:IPR041874" /db_xref="PDB:1ZNC" /db_xref="PDB:3F7B" /db_xref="PDB:3F7U" /db_xref="PDB:3FW3" /db_xref="PDB:5IPZ" /db_xref="PDB:5JN8" /db_xref="PDB:5JN9" /db_xref="PDB:5JNA" /db_xref="PDB:5JNC" /db_xref="PDB:5KU6" /db_xref="UniProtKB/Swiss-Prot:P22748" /protein_id="CAG46565.1" /translation="MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGG NCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISG GGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPE DEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYF RYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQL GQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR" BASE COUNT 220 a 271 c 279 g 169 t ORIGIN 1 atgcggatgc tgctggcgct cctggccctc tccgcggcgc ggccatcggc cagtgcagag 61 tcacactggt gctacgaggt tcaagccgag tcctccaact acccctgctt ggtgccagtc 121 aagtggggtg gaaactgcca gaaggaccgc cagtccccca tcaacatcgt caccaccaag 181 gcaaaggtgg acaaaaaact gggacgcttc ttcttctctg gctacgataa gaagcaaacg 241 tggactgtcc aaaataacgg gcactcagtg atgatgttgc tggagaacaa ggccagcatt 301 tctggaggag gactgcctgc cccataccag gccaaacagt tgcacctgca ctggtccgac 361 ttgccatata agggctcgga gcacagcctc gatggggagc actttgccat ggagatgcac 421 atagtacatg agaaagagaa ggggacatcg aggaatgtga aagaggccca ggaccctgaa 481 gacgaaattg cggtgctggc ctttctggtg gaggctggaa cccaggtgaa cgagggcttc 541 cagccactgg tggaggcact gtctaatatc cccaaacctg agatgagcac tacgatggca 601 gagagcagcc tgttggacct gctccccaag gaggagaaac tgaggcacta cttccgctac 661 ctgggctcac tcaccacacc gacctgcgat gagaaggtcg tctggactgt gttccgggag 721 cccattcagc ttcacagaga acagatcctg gcattctctc agaagctgta ctacgacaag 781 gaacagacag tgagcatgaa ggacaatgtc aggcccctgc agcagctggg gcagcgcacg 841 gtgataaagt ccggggcccc gggtcggccg ctgccctggg ccctgcctgc cctgctgggc 901 cccatgctgg cctgcctgct ggccggcttc ctgcgatga //