LOCUS       CR541753                 387 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G1029D for
            gene COX5B, cytochrome c oxidase subunit Vb; complete cds, without
            stopcodon.
ACCESSION   CR541753
VERSION     CR541753.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 387)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 387)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G1029D, ORFNo 3505
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G1029D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130983.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BT006742
            we found AA exchange(s) at position (first base of changed
            triplet):
            253(asn->asp)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..387
                     /db_xref="H-InvDB:HIT000268625"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G1029D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>387
                     /codon_start=1
                     /gene="COX5B"
                     /db_xref="GOA:Q6FHJ9"
                     /db_xref="H-InvDB:HIT000268625.11"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="InterPro:IPR020893"
                     /db_xref="InterPro:IPR036972"
                     /db_xref="UniProtKB/TrEMBL:Q6FHJ9"
                     /protein_id="CAG46553.1"
                     /translation="MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQA
                     TGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISDKRIVGCICEEDNTSVVW
                     FWLHKGEAQRCPRCGAHYKLVPQQLAH"
BASE COUNT           85 a          109 c          125 g           68 t
ORIGIN      
        1 atggcttcaa ggttacttcg cggagctgga acgctggccg cgcaggccct gagggctcgc
       61 ggccccagtg gcgcggccgc gatgcgctcc atggcatctg gaggtggtgt tcccactgat
      121 gaagagcagg cgactgggtt ggagagggag atcatgctgg ctgcaaagaa gggactggac
      181 ccatacaatg tactggcccc aaagggagct tcaggcacca gggaagaccc taatttagtc
      241 ccctccatct ccgacaagag aatagtaggc tgcatctgtg aagaggacaa taccagcgtc
      301 gtctggtttt ggctgcacaa aggcgaggcc cagcgatgcc cccgctgtgg agcccattac
      361 aagctggtgc cccagcagct ggcacac
//