LOCUS CR541753 387 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G1029D for gene COX5B, cytochrome c oxidase subunit Vb; complete cds, without stopcodon. ACCESSION CR541753 VERSION CR541753.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 387) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 387) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G1029D, ORFNo 3505 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G1029D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130983.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BT006742 we found AA exchange(s) at position (first base of changed triplet): 253(asn->asp) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..387 /db_xref="H-InvDB:HIT000268625" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G1029D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>387 /codon_start=1 /gene="COX5B" /db_xref="GOA:Q6FHJ9" /db_xref="H-InvDB:HIT000268625.11" /db_xref="InterPro:IPR002124" /db_xref="InterPro:IPR020893" /db_xref="InterPro:IPR036972" /db_xref="UniProtKB/TrEMBL:Q6FHJ9" /protein_id="CAG46553.1" /translation="MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQA TGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISDKRIVGCICEEDNTSVVW FWLHKGEAQRCPRCGAHYKLVPQQLAH" BASE COUNT 85 a 109 c 125 g 68 t ORIGIN 1 atggcttcaa ggttacttcg cggagctgga acgctggccg cgcaggccct gagggctcgc 61 ggccccagtg gcgcggccgc gatgcgctcc atggcatctg gaggtggtgt tcccactgat 121 gaagagcagg cgactgggtt ggagagggag atcatgctgg ctgcaaagaa gggactggac 181 ccatacaatg tactggcccc aaagggagct tcaggcacca gggaagaccc taatttagtc 241 ccctccatct ccgacaagag aatagtaggc tgcatctgtg aagaggacaa taccagcgtc 301 gtctggtttt ggctgcacaa aggcgaggcc cagcgatgcc cccgctgtgg agcccattac 361 aagctggtgc cccagcagct ggcacac //