LOCUS CR541751 384 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0929D for gene MRPL28, mitochondrial ribosomal protein L28; complete cds, without stopcodon. ACCESSION CR541751 VERSION CR541751.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 384) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 384) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0929D, ORFNo 3502 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0929D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence U19796 we found AA exchange(s) at position (first base of changed triplet): 94(glu->asp) 304(tyr->his) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..384 /db_xref="H-InvDB:HIT000268623" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0929D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>384 /codon_start=1 /gene="MRPL28" /db_xref="GOA:Q6FHK1" /db_xref="H-InvDB:HIT000268623.11" /db_xref="InterPro:IPR026569" /db_xref="UniProtKB/TrEMBL:Q6FHK1" /protein_id="CAG46551.1" /translation="MRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ DPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIH VAELIQQLQQQALSEPAVVQKTASGQ" BASE COUNT 87 a 107 c 129 g 61 t ORIGIN 1 atgcggaccc tggacctcat cgatgaggct tacgggctcg acttttacat cctcaagacc 61 ccgaaggagg acctgtgctc caagtttggg atggacctga agcgagggat gctgctgcgg 121 cttgcccggc aggaccccca gctgcacccc gaggaccccg agcggcgggc agccatctac 181 gacaagtaca aggaatttgc catcccagag gaggaggcag agtgggtggg cctcacgctg 241 gaggaggcca ttgagaagca gagacttttg gaggagaagg accctgtacc cctgttcaag 301 atccatgtgg cggagctgat ccagcagctg cagcagcagg cactgtcaga gccggcggtg 361 gtgcagaaga cagccagtgg ccag //