LOCUS CR541722 387 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0829D for gene CD59, CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); complete cds, incl. stopcodon. ACCESSION CR541722 VERSION CR541722.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 387) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 387) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0829D, ORFNo 3446 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0829D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_000611 (GI:42716300) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..387 /db_xref="H-InvDB:HIT000268595" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0829D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..387 /codon_start=1 /gene="CD59" /db_xref="GOA:Q6FHM9" /db_xref="H-InvDB:HIT000268595.11" /db_xref="InterPro:IPR016054" /db_xref="InterPro:IPR018363" /db_xref="InterPro:IPR027101" /db_xref="UniProtKB/TrEMBL:Q6FHM9" /protein_id="CAG46523.1" /translation="MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN GGTSLSEKTVLLLVTPFLAAAWSLHP" BASE COUNT 98 a 93 c 91 g 105 t ORIGIN 1 atgggaatcc aaggagggtc tgtcctgttc gggctgctgc tcgtcctggc tgtcttctgc 61 cattcaggtc atagcctgca gtgctacaac tgtcctaacc caactgctga ctgcaaaaca 121 gccgtcaatt gttcatctga ttttgatgcg tgtctcatta ccaaagctgg gttacaagtg 181 tataacaagt gttggaagtt tgagcattgc aatttcaacg acgtcacaac ccgcttgagg 241 gaaaatgagc taacgtacta ctgctgcaag aaggacctgt gtaactttaa cgaacagctt 301 gaaaatggtg ggacatcctt atcagagaaa acagttcttc tgctggtgac tccatttctg 361 gcagcagcct ggagccttca tccctaa //