LOCUS       CR541722                 387 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0829D for
            gene CD59, CD59 antigen p18-20 (antigen identified by monoclonal
            antibodies 16.3A5, EJ16, EJ30, EL32 and G344); complete cds, incl.
            stopcodon.
ACCESSION   CR541722
VERSION     CR541722.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 387)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 387)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0829D, ORFNo 3446
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0829D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_000611 (GI:42716300)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..387
                     /db_xref="H-InvDB:HIT000268595"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0829D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..387
                     /codon_start=1
                     /gene="CD59"
                     /db_xref="GOA:Q6FHM9"
                     /db_xref="H-InvDB:HIT000268595.11"
                     /db_xref="InterPro:IPR016054"
                     /db_xref="InterPro:IPR018363"
                     /db_xref="InterPro:IPR027101"
                     /db_xref="UniProtKB/TrEMBL:Q6FHM9"
                     /protein_id="CAG46523.1"
                     /translation="MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNC
                     SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
                     GGTSLSEKTVLLLVTPFLAAAWSLHP"
BASE COUNT           98 a           93 c           91 g          105 t
ORIGIN      
        1 atgggaatcc aaggagggtc tgtcctgttc gggctgctgc tcgtcctggc tgtcttctgc
       61 cattcaggtc atagcctgca gtgctacaac tgtcctaacc caactgctga ctgcaaaaca
      121 gccgtcaatt gttcatctga ttttgatgcg tgtctcatta ccaaagctgg gttacaagtg
      181 tataacaagt gttggaagtt tgagcattgc aatttcaacg acgtcacaac ccgcttgagg
      241 gaaaatgagc taacgtacta ctgctgcaag aaggacctgt gtaactttaa cgaacagctt
      301 gaaaatggtg ggacatcctt atcagagaaa acagttcttc tgctggtgac tccatttctg
      361 gcagcagcct ggagccttca tccctaa
//