LOCUS       CR541716                 246 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0529D for
            gene NDUFA4, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4,
            9kDa; complete cds, incl. stopcodon.
ACCESSION   CR541716
VERSION     CR541716.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 246)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 246)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0529D, ORFNo 3431
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0529D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130970.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_002489 (GI:33519463)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..246
                     /db_xref="H-InvDB:HIT000268589"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0529D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..246
                     /codon_start=1
                     /gene="NDUFA4"
                     /db_xref="GOA:O00483"
                     /db_xref="H-InvDB:HIT000268589.13"
                     /db_xref="HGNC:HGNC:7687"
                     /db_xref="InterPro:IPR010530"
                     /db_xref="PDB:5Z62"
                     /db_xref="UniProtKB/Swiss-Prot:O00483"
                     /protein_id="CAG46517.1"
                     /translation="MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVC
                     WDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF"
BASE COUNT           69 a           58 c           56 g           63 t
ORIGIN      
        1 atgctccgcc agatcatcgg tcaggccaag aagcatccga gcttgatccc cctctttgta
       61 tttattggaa ctggagctac tggagcaaca ctgtatctct tgcgtctggc attgttcaat
      121 ccagatgttt gttgggacag aaataaccca gagccctgga acaaactggg tcccaatgat
      181 caatacaagt tctactcagt gaatgtggat tacagcaagc tgaagaagga acgtccagat
      241 ttctaa
//