LOCUS CR541712 891 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0129D for gene MPST, mercaptopyruvate sulfurtransferase; complete cds, without stopcodon. ACCESSION CR541712 VERSION CR541712.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 891) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 891) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0129D, ORFNo 3410 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0129D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH130963.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_021126 (GI:23510449) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..891 /db_xref="H-InvDB:HIT000268585" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0129D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>891 /codon_start=1 /gene="MPST" /db_xref="GOA:P25325" /db_xref="H-InvDB:HIT000268585.13" /db_xref="HGNC:HGNC:7223" /db_xref="InterPro:IPR001307" /db_xref="InterPro:IPR001763" /db_xref="InterPro:IPR036873" /db_xref="PDB:3OLH" /db_xref="PDB:4JGT" /db_xref="UniProtKB/Swiss-Prot:P25325" /protein_id="CAG46513.1" /translation="MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRD ARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDA SDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDP AFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLS QEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSW VEWYMRARPEDVISEGRGKTH" BASE COUNT 147 a 320 c 285 g 139 t ORIGIN 1 atggcttcgc cgcagctctg ccgcgcgctg gtgtcggcgc aatgggtggc ggaggcgctg 61 cgggccccgc gcgctgggca gcctctgcag ctgctggacg cctcctggta cctgccgaag 121 ctggggcgcg acgcgcgacg cgagttcgag gagcgccaca tcccgggcgc cgctttcttc 181 gacatcgacc agtgcagcga ccgcacctcg ccctacgacc acatgctgcc cggggccgag 241 catttcgcgg agtacgcagg ccgcctgggc gtgggcgcgg ccacccacgt cgtgatctac 301 gacgccagcg accagggcct ctactccgcc ccgcgcgtct ggtggatgtt ccgcgccttc 361 ggccaccacg ccgtgtcact gcttgatggc ggcctccgcc actggctgcg ccagaacctc 421 ccgctcagct ccggcaagag ccaacctgct cccgccgagt tccgcgctca gctcgacccc 481 gccttcatca agacctacga ggacatcaag gagaacctgg aatcccggcg cttccaggtg 541 gtggactccc gagccactgg caggttccgc ggcaccgagc ccgagccccg agacggcatt 601 gaacctggcc acatcccagg taccgtgaac atccccttca cagacttcct gagccaggag 661 gggctggaga agagccctga ggagatccgc catctgttcc aggagaagaa agtggacctg 721 tctaagccac tggtggccac gtgtggctct ggcgtcacag cctgccacgt ggcactaggg 781 gcctacctct gcggcaagcc agacgtgccc atctacgatg gctcctgggt ggagtggtac 841 atgcgcgccc ggcccgagga tgtcatctca gagggccggg ggaagaccca c //