LOCUS       CR541712                 891 bp    mRNA    linear   HUM 29-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0129D for
            gene MPST, mercaptopyruvate sulfurtransferase; complete cds,
            without stopcodon.
ACCESSION   CR541712
VERSION     CR541712.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 891)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 891)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0129D, ORFNo 3410
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0129D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH130963.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_021126 (GI:23510449)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..891
                     /db_xref="H-InvDB:HIT000268585"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0129D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>891
                     /codon_start=1
                     /gene="MPST"
                     /db_xref="GOA:P25325"
                     /db_xref="H-InvDB:HIT000268585.13"
                     /db_xref="HGNC:HGNC:7223"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR036873"
                     /db_xref="PDB:3OLH"
                     /db_xref="PDB:4JGT"
                     /db_xref="UniProtKB/Swiss-Prot:P25325"
                     /protein_id="CAG46513.1"
                     /translation="MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRD
                     ARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDA
                     SDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDP
                     AFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLS
                     QEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSW
                     VEWYMRARPEDVISEGRGKTH"
BASE COUNT          147 a          320 c          285 g          139 t
ORIGIN      
        1 atggcttcgc cgcagctctg ccgcgcgctg gtgtcggcgc aatgggtggc ggaggcgctg
       61 cgggccccgc gcgctgggca gcctctgcag ctgctggacg cctcctggta cctgccgaag
      121 ctggggcgcg acgcgcgacg cgagttcgag gagcgccaca tcccgggcgc cgctttcttc
      181 gacatcgacc agtgcagcga ccgcacctcg ccctacgacc acatgctgcc cggggccgag
      241 catttcgcgg agtacgcagg ccgcctgggc gtgggcgcgg ccacccacgt cgtgatctac
      301 gacgccagcg accagggcct ctactccgcc ccgcgcgtct ggtggatgtt ccgcgccttc
      361 ggccaccacg ccgtgtcact gcttgatggc ggcctccgcc actggctgcg ccagaacctc
      421 ccgctcagct ccggcaagag ccaacctgct cccgccgagt tccgcgctca gctcgacccc
      481 gccttcatca agacctacga ggacatcaag gagaacctgg aatcccggcg cttccaggtg
      541 gtggactccc gagccactgg caggttccgc ggcaccgagc ccgagccccg agacggcatt
      601 gaacctggcc acatcccagg taccgtgaac atccccttca cagacttcct gagccaggag
      661 gggctggaga agagccctga ggagatccgc catctgttcc aggagaagaa agtggacctg
      721 tctaagccac tggtggccac gtgtggctct ggcgtcacag cctgccacgt ggcactaggg
      781 gcctacctct gcggcaagcc agacgtgccc atctacgatg gctcctgggt ggagtggtac
      841 atgcgcgccc ggcccgagga tgtcatctca gagggccggg ggaagaccca c
//