LOCUS       CR541710                 849 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H1128D for
            gene MTAP, methylthioadenosine phosphorylase; complete cds, without
            stopcodon.
ACCESSION   CR541710
VERSION     CR541710.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 849)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 849)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H1128D, ORFNo 3404
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1128D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131058.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_002451 (GI:6006025)
            we found AA exchange(s) at position (first base of changed
            triplet):
            133(leu->ser) 166(ile->val)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..849
                     /db_xref="H-InvDB:HIT000268583"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H1128D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>849
                     /codon_start=1
                     /gene="MTAP"
                     /db_xref="GOA:Q6FHP1"
                     /db_xref="H-InvDB:HIT000268583.12"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="InterPro:IPR035994"
                     /db_xref="UniProtKB/TrEMBL:Q6FHP1"
                     /protein_id="CAG46511.1"
                     /translation="MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDA
                     SILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEI
                     QPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLG
                     LRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMA
                     TDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQF
                     SVLLPRH"
BASE COUNT          240 a          191 c          218 g          200 t
ORIGIN      
        1 atggcctctg gcaccaccac caccgccgtg aagattggaa taattggtgg aacaggcctg
       61 gatgatccag aaattttaga aggaagaact gaaaaatatg tggatactcc atttggcaag
      121 ccatctgatg cctcaatttt ggggaagata aaaaatgttg attgcgtcct ccttgcaagg
      181 catggaaggc agcacaccat catgccttca aaggtcaact accaggcgaa catctgggct
      241 ttgaaggaag agggctgtac acatgtcata gtgaccacag cttgtggctc cttgagggag
      301 gagattcagc ccggcgatat tgtcattatt gatcagttca ttgacaggac cactatgaga
      361 cctcagtcct tctatgatgg aagtcattct tgtgccagag gagtgtgcca tattccaatg
      421 gctgagccgt tttgccccaa aacgagagag gttcttatag agactgctaa gaagctagga
      481 ctccggtgcc actcaaaggg gacaatggtc acaatcgagg gacctcgttt tagctcccgg
      541 gcagaaagct tcatgttccg cacctggggg gcggatgtta tcaacatgac cacagttcca
      601 gaggtggttc ttgctaagga ggctggaatt tgttacgcaa gtatcgccat ggcgacagat
      661 tatgactgct ggaaggagca cgaggaagca gtttcggtgg accgggtctt aaagaccctg
      721 aaagaaaacg ctaataaagc caaaagctta ctgctcacta ccatacctca gatagggtcc
      781 acagaatggt cagaaaccct ccataacctg aagaatatgg cccagttttc tgttttatta
      841 ccaagacat
//