LOCUS CR541710 849 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1128D for gene MTAP, methylthioadenosine phosphorylase; complete cds, without stopcodon. ACCESSION CR541710 VERSION CR541710.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 849) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 849) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1128D, ORFNo 3404 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1128D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131058.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_002451 (GI:6006025) we found AA exchange(s) at position (first base of changed triplet): 133(leu->ser) 166(ile->val) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..849 /db_xref="H-InvDB:HIT000268583" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1128D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>849 /codon_start=1 /gene="MTAP" /db_xref="GOA:Q6FHP1" /db_xref="H-InvDB:HIT000268583.12" /db_xref="InterPro:IPR000845" /db_xref="InterPro:IPR010044" /db_xref="InterPro:IPR018099" /db_xref="InterPro:IPR035994" /db_xref="UniProtKB/TrEMBL:Q6FHP1" /protein_id="CAG46511.1" /translation="MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDA SILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEI QPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLG LRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMA TDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQF SVLLPRH" BASE COUNT 240 a 191 c 218 g 200 t ORIGIN 1 atggcctctg gcaccaccac caccgccgtg aagattggaa taattggtgg aacaggcctg 61 gatgatccag aaattttaga aggaagaact gaaaaatatg tggatactcc atttggcaag 121 ccatctgatg cctcaatttt ggggaagata aaaaatgttg attgcgtcct ccttgcaagg 181 catggaaggc agcacaccat catgccttca aaggtcaact accaggcgaa catctgggct 241 ttgaaggaag agggctgtac acatgtcata gtgaccacag cttgtggctc cttgagggag 301 gagattcagc ccggcgatat tgtcattatt gatcagttca ttgacaggac cactatgaga 361 cctcagtcct tctatgatgg aagtcattct tgtgccagag gagtgtgcca tattccaatg 421 gctgagccgt tttgccccaa aacgagagag gttcttatag agactgctaa gaagctagga 481 ctccggtgcc actcaaaggg gacaatggtc acaatcgagg gacctcgttt tagctcccgg 541 gcagaaagct tcatgttccg cacctggggg gcggatgtta tcaacatgac cacagttcca 601 gaggtggttc ttgctaagga ggctggaatt tgttacgcaa gtatcgccat ggcgacagat 661 tatgactgct ggaaggagca cgaggaagca gtttcggtgg accgggtctt aaagaccctg 721 aaagaaaacg ctaataaagc caaaagctta ctgctcacta ccatacctca gatagggtcc 781 acagaatggt cagaaaccct ccataacctg aagaatatgg cccagttttc tgttttatta 841 ccaagacat //