LOCUS       CR541706                 816 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G0928D for
            gene PHB, prohibitin; complete cds, without stopcodon.
ACCESSION   CR541706
VERSION     CR541706.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 816)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 816)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G0928D, ORFNo 3395
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0928D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131053.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_002634 (GI:6031190)
            we found AA exchange(s) at position (first base of changed
            triplet):
            472(ala->val)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..816
                     /db_xref="H-InvDB:HIT000268579"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G0928D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>816
                     /codon_start=1
                     /gene="PHB"
                     /db_xref="GOA:Q6FHP5"
                     /db_xref="H-InvDB:HIT000268579.14"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR036013"
                     /db_xref="UniProtKB/TrEMBL:Q6FHP5"
                     /protein_id="CAG46507.1"
                     /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRG
                     VQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQ
                     LPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERVAT
                     FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDS
                     KAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
BASE COUNT          186 a          218 c          234 g          178 t
ORIGIN      
        1 atggctgcca aagtgtttga gtccattggc aagtttggcc tggccttagc tgttgcagga
       61 ggcgtggtga actctgcctt atataatgtg gatgctgggc acagagctgt catctttgac
      121 cgattccgtg gagtgcagga cattgtggta ggggaaggga ctcattttct catcccgtgg
      181 gtacagaaac caattatctt tgactgccgt tctcgaccac gtaatgtgcc agtcatcact
      241 ggtagcaaag atttacagaa tgtcaacatc acactgcgca tcctcttccg gcctgtcgcc
      301 agccagcttc ctcgcatctt caccagcatc ggagaggact atgatgagcg tgtgctgccg
      361 tccatcacaa ctgagatcct caagtcagtg gtggctcgct ttgatgctgg agaactaatc
      421 acccagagag agctggtctc caggcaggtg agcgacgacc ttacagagcg agtcgccacc
      481 tttgggctca tcctggatga cgtgtccttg acacatctga ccttcgggaa ggagttcaca
      541 gaagcggtgg aagccaaaca ggtggctcag caggaagcag agagggccag atttgtggtg
      601 gaaaaggctg agcaacagaa aaaggcggcc atcatctctg ctgagggcga ctccaaggca
      661 gctgagctga ttgccaactc actggccact gcaggggatg gcctgatcga gctgcgcaag
      721 ctggaagctg cagaggacat cgcgtaccag ctctcacgct ctcggaacat cacctacctg
      781 ccagcggggc agtccgtgct cctccagctg ccccag
//