LOCUS CR541706 816 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0928D for gene PHB, prohibitin; complete cds, without stopcodon. ACCESSION CR541706 VERSION CR541706.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 816) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 816) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0928D, ORFNo 3395 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0928D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131053.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_002634 (GI:6031190) we found AA exchange(s) at position (first base of changed triplet): 472(ala->val) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..816 /db_xref="H-InvDB:HIT000268579" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0928D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>816 /codon_start=1 /gene="PHB" /db_xref="GOA:Q6FHP5" /db_xref="H-InvDB:HIT000268579.14" /db_xref="InterPro:IPR000163" /db_xref="InterPro:IPR001107" /db_xref="InterPro:IPR036013" /db_xref="UniProtKB/TrEMBL:Q6FHP5" /protein_id="CAG46507.1" /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRG VQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQ LPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERVAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDS KAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ" BASE COUNT 186 a 218 c 234 g 178 t ORIGIN 1 atggctgcca aagtgtttga gtccattggc aagtttggcc tggccttagc tgttgcagga 61 ggcgtggtga actctgcctt atataatgtg gatgctgggc acagagctgt catctttgac 121 cgattccgtg gagtgcagga cattgtggta ggggaaggga ctcattttct catcccgtgg 181 gtacagaaac caattatctt tgactgccgt tctcgaccac gtaatgtgcc agtcatcact 241 ggtagcaaag atttacagaa tgtcaacatc acactgcgca tcctcttccg gcctgtcgcc 301 agccagcttc ctcgcatctt caccagcatc ggagaggact atgatgagcg tgtgctgccg 361 tccatcacaa ctgagatcct caagtcagtg gtggctcgct ttgatgctgg agaactaatc 421 acccagagag agctggtctc caggcaggtg agcgacgacc ttacagagcg agtcgccacc 481 tttgggctca tcctggatga cgtgtccttg acacatctga ccttcgggaa ggagttcaca 541 gaagcggtgg aagccaaaca ggtggctcag caggaagcag agagggccag atttgtggtg 601 gaaaaggctg agcaacagaa aaaggcggcc atcatctctg ctgagggcga ctccaaggca 661 gctgagctga ttgccaactc actggccact gcaggggatg gcctgatcga gctgcgcaag 721 ctggaagctg cagaggacat cgcgtaccag ctctcacgct ctcggaacat cacctacctg 781 ccagcggggc agtccgtgct cctccagctg ccccag //