LOCUS       CR541697                 738 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0428D for
            gene MED6, mediator of RNA polymerase II transcription, subunit 6
            homolog (yeast); complete cds, without stopcodon.
ACCESSION   CR541697
VERSION     CR541697.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 738)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 738)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0428D, ORFNo 3373
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0428D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_005466 (GI:42544154)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..738
                     /db_xref="H-InvDB:HIT000268570"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0428D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>738
                     /codon_start=1
                     /gene="MED6"
                     /db_xref="GOA:O75586"
                     /db_xref="H-InvDB:HIT000268570.12"
                     /db_xref="HGNC:HGNC:19970"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="InterPro:IPR016820"
                     /db_xref="InterPro:IPR038566"
                     /db_xref="UniProtKB/Swiss-Prot:O75586"
                     /protein_id="CAG46498.1"
                     /translation="MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRT
                     CNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIA
                     GVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRP
                     KAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETV
                     KPEEKETTKNVQQTVSAKGPPEKRMRLQ"
BASE COUNT          237 a          149 c          165 g          187 t
ORIGIN      
        1 atggcggcgg tggatatccg agacaatctg ctgggaattt cttgggttga cagctcttgg
       61 atccctattt tgaacagtgg tagtgtcctg gattactttt cagaaagaag taatcctttt
      121 tatgacagaa catgtaataa tgaagtggtt aaaatgcaga ggctaacatt agaacacttg
      181 aatcagatgg ttggaatcga gtacatcctt ttgcatgctc aagagcccat tcttttcatc
      241 attcggaagc aacagcggca gtcccctgcc caagttatcc cactagctga ttactatatc
      301 attgctggag tgatctatca ggcaccagac ttgggatcag ttataaactc tagagtgctt
      361 actgcagtgc atggtattca gtcagctttt gatgaagcta tgtcatactg tcgatatcat
      421 ccttccaaag ggtattggtg gcacttcaaa gatcatgaag agcaagataa agtcagacct
      481 aaagccaaaa ggaaagaaga accaagctct atttttcaga gacaacgtgt ggatgcttta
      541 cttttagacc tcagacaaaa atttccaccc aaatttgtgc agctaaagcc tggagaaaag
      601 cctgttccag tggatcaaac aaagaaagag gcagaaccta taccagaaac tgtaaaacct
      661 gaggagaagg agaccacaaa gaatgtacaa cagacagtga gtgctaaagg cccccctgaa
      721 aaacggatga gacttcag
//