LOCUS CR541697 738 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0428D for gene MED6, mediator of RNA polymerase II transcription, subunit 6 homolog (yeast); complete cds, without stopcodon. ACCESSION CR541697 VERSION CR541697.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 738) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 738) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0428D, ORFNo 3373 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0428D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_005466 (GI:42544154) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..738 /db_xref="H-InvDB:HIT000268570" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0428D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>738 /codon_start=1 /gene="MED6" /db_xref="GOA:O75586" /db_xref="H-InvDB:HIT000268570.12" /db_xref="HGNC:HGNC:19970" /db_xref="InterPro:IPR007018" /db_xref="InterPro:IPR016820" /db_xref="InterPro:IPR038566" /db_xref="UniProtKB/Swiss-Prot:O75586" /protein_id="CAG46498.1" /translation="MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRT CNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIA GVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRP KAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETV KPEEKETTKNVQQTVSAKGPPEKRMRLQ" BASE COUNT 237 a 149 c 165 g 187 t ORIGIN 1 atggcggcgg tggatatccg agacaatctg ctgggaattt cttgggttga cagctcttgg 61 atccctattt tgaacagtgg tagtgtcctg gattactttt cagaaagaag taatcctttt 121 tatgacagaa catgtaataa tgaagtggtt aaaatgcaga ggctaacatt agaacacttg 181 aatcagatgg ttggaatcga gtacatcctt ttgcatgctc aagagcccat tcttttcatc 241 attcggaagc aacagcggca gtcccctgcc caagttatcc cactagctga ttactatatc 301 attgctggag tgatctatca ggcaccagac ttgggatcag ttataaactc tagagtgctt 361 actgcagtgc atggtattca gtcagctttt gatgaagcta tgtcatactg tcgatatcat 421 ccttccaaag ggtattggtg gcacttcaaa gatcatgaag agcaagataa agtcagacct 481 aaagccaaaa ggaaagaaga accaagctct atttttcaga gacaacgtgt ggatgcttta 541 cttttagacc tcagacaaaa atttccaccc aaatttgtgc agctaaagcc tggagaaaag 601 cctgttccag tggatcaaac aaagaaagag gcagaaccta taccagaaac tgtaaaacct 661 gaggagaagg agaccacaaa gaatgtacaa cagacagtga gtgctaaagg cccccctgaa 721 aaacggatga gacttcag //