LOCUS CR541689 1122 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0928D for gene ADH5, alcohol dehydrogenase 5 (class III), chi polypeptide; complete cds, without stopcodon. ACCESSION CR541689 VERSION CR541689.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1122) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1122) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0928D, ORFNo 3348 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0928D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131051.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence BC014665 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1122 /db_xref="H-InvDB:HIT000268562" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0928D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>1122 /codon_start=1 /gene="ADH5" /db_xref="GOA:P11766" /db_xref="H-InvDB:HIT000268562.12" /db_xref="HGNC:HGNC:253" /db_xref="InterPro:IPR002328" /db_xref="InterPro:IPR011032" /db_xref="InterPro:IPR013149" /db_xref="InterPro:IPR013154" /db_xref="InterPro:IPR014183" /db_xref="InterPro:IPR036291" /db_xref="PDB:1M6H" /db_xref="PDB:1M6W" /db_xref="PDB:1MA0" /db_xref="PDB:1MC5" /db_xref="PDB:1MP0" /db_xref="PDB:1TEH" /db_xref="PDB:2FZE" /db_xref="PDB:2FZW" /db_xref="PDB:3QJ5" /db_xref="UniProtKB/Swiss-Prot:P11766" /protein_id="CAG46490.1" /translation="MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAV CHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKF CLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKI DPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASR IIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMR AALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSE YMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI" BASE COUNT 304 a 209 c 306 g 303 t ORIGIN 1 atggcgaacg aggttatcaa gtgcaaggct gcagttgctt gggaggctgg aaagcctctc 61 tccatagagg agatagaggt ggcaccccca aaggctcatg aagttcgaat caagatcatt 121 gccactgcgg tttgccacac cgatgcctat accctgagtg gagctgatcc tgagggttgt 181 tttccagtga tcttgggaca tgaaggtgct ggaattgtgg aaagtgttgg tgagggagtt 241 actaagctga aggcgggtga cactgtcatc ccactttaca tcccacagtg tggagaatgc 301 aaattttgtc taaatcctaa aactaacctt tgccagaaga taagagtcac tcaagggaaa 361 ggattaatgc cagatggtac cagcagattt acttgcaaag gaaagacaat tttgcattac 421 atgggaacca gcacattttc tgaatacaca gttgtggctg atatctctgt tgctaaaata 481 gatcctttag cacctttgga taaagtctgc cttctaggtt gtggcatttc aaccggttat 541 ggtgctgctg tgaacactgc caagttggag cctggctctg tttgtgccgt ctttggtctg 601 ggaggagtcg gattggcagt tatcatgggc tgtaaagtgg ctggtgcttc ccggatcatt 661 ggtgtggaca tcaataaaga taaatttgca agggccaaag agtttggagc cactgaatgt 721 attaaccctc aggattttag taaacccatc caggaagtgc tcattgagat gaccgatgga 781 ggagtggact attcctttga atgtattggt aatgtgaagg tcatgagagc agcacttgag 841 gcatgtcaca agggctgggg cgtcagcgtc gtggttggag tagctgcttc aggtgaagaa 901 attgccactc gtccattcca gctggtaaca ggtcgcacat ggaaaggcac tgcctttgga 961 ggatggaaga gtgtagaaag tgtcccaaag ttggtgtctg aatatatgtc caaaaagata 1021 aaagttgatg aatttgtgac tcacaatctg tcttttgatg aaatcaacaa agcctttgaa 1081 ctgatgcatt ctggaaagag cattcgaact gttgtaaaga tt //