LOCUS CR541687 1095 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0828D for gene MAPK13, mitogen-activated protein kinase 13; complete cds, without stopcodon. ACCESSION CR541687 VERSION CR541687.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1095) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1095) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0828D, ORFNo 3343 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0828D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131045.01L This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_002754 (GI:20986527) we found AA exchange(s) at position (first base of changed triplet): 874(asp->gly) 1030(lys->asn) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1095 /db_xref="H-InvDB:HIT000268560" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0828D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>1095 /codon_start=1 /gene="MAPK13" /db_xref="GOA:Q6FHR4" /db_xref="H-InvDB:HIT000268560.13" /db_xref="InterPro:IPR000719" /db_xref="InterPro:IPR003527" /db_xref="InterPro:IPR008352" /db_xref="InterPro:IPR011009" /db_xref="InterPro:IPR017441" /db_xref="InterPro:IPR038785" /db_xref="UniProtKB/TrEMBL:Q6FHR4" /protein_id="CAG46488.1" /translation="MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAID KRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYD FYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNE DCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLT GKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPR ASPQAADLLEKMLELGVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLT VDEWKQHIYNEIVNFSPIARKDSRRRSGMKL" BASE COUNT 257 a 310 c 324 g 204 t ORIGIN 1 atgagcctca tccggaaaaa gggcttctac aagcaggacg tcaacaagac cgcctgggag 61 ctgcccaaga cctacgtgtc cccgacgcac gtcggcagcg gggcctatgg ctccgtgtgc 121 tcggccatcg acaagcggtc gggggagaag gtggccatca agaagctgag ccgacccttt 181 cagtccgaga tcttcgccaa gcgcgcctac cgggagctgc tgctgctgaa gcacatgcag 241 catgagaacg tcattgggct cctggatgtc ttcaccccag cctcctccct gcgcaacttc 301 tatgacttct acctggtgat gcccttcatg cagacggatc tgcagaagat catggggatg 361 gagttcagtg aggagaagat ccagtacctg gtgtatcaga tgctcaaagg ccttaagtac 421 atccactctg ctggggtcgt gcacagggac ctgaagccag gcaacctggc tgtgaatgag 481 gactgtgaac tgaagattct ggattttggg ctggcgcgac atgcagacgc cgagatgact 541 ggctacgtgg tgacccgctg gtaccgagcc cccgaggtga tcctcagctg gatgcactac 601 aaccagacag tggacatctg gtctgtgggc tgtatcatgg cagagatgct gacagggaaa 661 actctgttca aggggaaaga ttacctggac cagctgaccc agatcctgaa agtgaccggg 721 gtgcctggca cggagtttgt gcagaagctg aacgacaaag cggccaaatc ctacatccag 781 tccctgccac agacccccag gaaggatttc actcagctgt tcccacgggc cagcccccag 841 gctgcggacc tgctggagaa gatgctggag ctaggcgtgg acaagcgcct gacggccgcg 901 caggccctca cccatccctt ctttgaaccc ttccgggacc ctgaggaaga gacggaggcc 961 cagcagccgt ttgatgattc cttagaacac gagaaactca cagtggatga atggaagcag 1021 cacatctaca atgagattgt gaacttcagc cccattgccc ggaaggactc acggcgccgg 1081 agtggcatga agctg //