LOCUS       CR541682                 603 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0628D for
            gene RNP24, coated vesicle membrane protein; complete cds, without
            stopcodon.
ACCESSION   CR541682
VERSION     CR541682.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 603)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 603)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0628D, ORFNo 3335
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0628D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131036.01L
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_006815 (GI:21314646)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..603
                     /db_xref="H-InvDB:HIT000268555"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0628D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>603
                     /codon_start=1
                     /gene="RNP24"
                     /db_xref="GOA:Q6FHT8"
                     /db_xref="H-InvDB:HIT000268555.13"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="InterPro:IPR036598"
                     /db_xref="UniProtKB/TrEMBL:Q6FHT8"
                     /protein_id="CAG46483.1"
                     /translation="MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMG
                     LIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMT
                     PKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRA
                     INDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV"
BASE COUNT          174 a          131 c          160 g          138 t
ORIGIN      
        1 atggtgacgc ttgctgaact gctggtgctc ctggccgctc tcctggccac ggtctcgggc
       61 tatttcgtta gcatcgacgc ccatgctgaa gagtgcttct ttgagcgggt cacctcgggc
      121 accaagatgg gcctcatctt cgaggtggcg gagggcggct tcctggacat cgacgtggag
      181 attacaggac cagataacaa aggaatttac aaaggagaca gagaatccag tgggaaatac
      241 acatttgctg ctcacatgga tggaacatac aaattttgtt ttagtaaccg gatgtccacc
      301 atgactccaa aaatagtgat gttcaccatt gatattgggg aggctccaaa aggacaagat
      361 atggaaacag aagctcacca gaacaagcta gaagaaatga tcaatgagct agcagtggcg
      421 atgacagctg taaagcacga acaggaatac atggaagtcc gggagagaat acacagagcc
      481 atcaacgaca acacaaacag cagagtggtc ctttggtcct tctttgaagc tcttgttcta
      541 gttgccatga cattgggaca gatctactac ctgaagagat tttttgaagt ccggagagtt
      601 gtt
//