LOCUS CR541671 855 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1127D for gene ICMT, isoprenylcysteine carboxyl methyltransferase; complete cds, incl. stopcodon. ACCESSION CR541671 VERSION CR541671.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 855) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 855) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1127D, ORFNo 3306 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1127D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_012405 (GI:24797154) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..855 /db_xref="H-InvDB:HIT000268544" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1127D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..855 /codon_start=1 /gene="ICMT" /db_xref="GOA:O60725" /db_xref="H-InvDB:HIT000268544.12" /db_xref="HGNC:HGNC:5350" /db_xref="InterPro:IPR007269" /db_xref="InterPro:IPR025770" /db_xref="UniProtKB/Swiss-Prot:O60725" /protein_id="CAG46472.1" /translation="MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGL ALYVAGLNALLLLLYRPPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSL FHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLS VTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFY WSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPF IKGVKVDL" BASE COUNT 161 a 226 c 243 g 225 t ORIGIN 1 atggcgggct gcgcggcgcg ggctccgccg ggctctgagg cgcgtctcag cctcgccacc 61 ttcctgctgg gcgcctcggt gctcgcgctg ccgctgctca cgcgcgccgg cctgcagggc 121 cgcaccgggc tggcgctcta cgtggccggg ctcaacgcgc tgctgctgct gctctatcgg 181 ccgcctcgct accagatagc catccgagct tgtttcctgg ggtttgtgtt cggctgcggc 241 acgctgctaa gttttagcca gtcttcttgg agtcactttg gctggtacat gtgctccctg 301 tcattgttcc actattctga atacttggtg acagcagtca ataatcccaa aagtctgtcc 361 ttggattcct ttctcctgaa tcacagcctg gagtatacag tagctgctct ttcttcttgg 421 ttagagttca cacttgaaaa tatcttttgg ccagaactga agcagattac ctggctcagt 481 gtcacagggc tgctgatggt ggtcttcgga gaatgtctga ggaaggcggc catgtttaca 541 gctggctcca atttcaacca cgtggtacag aatgaaaaat cagatacaca tactctggtg 601 accagtggag tgtacgcttg gtttcggcat ccttcttacg tcgggtggtt ttactggagt 661 attggaactc aggtgatgct gtgtaacccc atctgcggcg tcagctatgc cctgacagtg 721 tggcgattct tccgcgatcg aacagaagaa gaagaaatct cactaattca cttttttgga 781 gaggagtacc tggagtataa gaagagggtg cccacgggcc tgcctttcat aaagggggtc 841 aaggtggacc tgtga //