LOCUS       CR541671                 855 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H1127D for
            gene ICMT, isoprenylcysteine carboxyl methyltransferase; complete
            cds, incl. stopcodon.
ACCESSION   CR541671
VERSION     CR541671.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 855)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 855)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H1127D, ORFNo 3306
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1127D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_012405 (GI:24797154)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..855
                     /db_xref="H-InvDB:HIT000268544"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H1127D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..855
                     /codon_start=1
                     /gene="ICMT"
                     /db_xref="GOA:O60725"
                     /db_xref="H-InvDB:HIT000268544.12"
                     /db_xref="HGNC:HGNC:5350"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/Swiss-Prot:O60725"
                     /protein_id="CAG46472.1"
                     /translation="MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGL
                     ALYVAGLNALLLLLYRPPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSL
                     FHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLS
                     VTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFY
                     WSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPF
                     IKGVKVDL"
BASE COUNT          161 a          226 c          243 g          225 t
ORIGIN      
        1 atggcgggct gcgcggcgcg ggctccgccg ggctctgagg cgcgtctcag cctcgccacc
       61 ttcctgctgg gcgcctcggt gctcgcgctg ccgctgctca cgcgcgccgg cctgcagggc
      121 cgcaccgggc tggcgctcta cgtggccggg ctcaacgcgc tgctgctgct gctctatcgg
      181 ccgcctcgct accagatagc catccgagct tgtttcctgg ggtttgtgtt cggctgcggc
      241 acgctgctaa gttttagcca gtcttcttgg agtcactttg gctggtacat gtgctccctg
      301 tcattgttcc actattctga atacttggtg acagcagtca ataatcccaa aagtctgtcc
      361 ttggattcct ttctcctgaa tcacagcctg gagtatacag tagctgctct ttcttcttgg
      421 ttagagttca cacttgaaaa tatcttttgg ccagaactga agcagattac ctggctcagt
      481 gtcacagggc tgctgatggt ggtcttcgga gaatgtctga ggaaggcggc catgtttaca
      541 gctggctcca atttcaacca cgtggtacag aatgaaaaat cagatacaca tactctggtg
      601 accagtggag tgtacgcttg gtttcggcat ccttcttacg tcgggtggtt ttactggagt
      661 attggaactc aggtgatgct gtgtaacccc atctgcggcg tcagctatgc cctgacagtg
      721 tggcgattct tccgcgatcg aacagaagaa gaagaaatct cactaattca cttttttgga
      781 gaggagtacc tggagtataa gaagagggtg cccacgggcc tgcctttcat aaagggggtc
      841 aaggtggacc tgtga
//