LOCUS       CR541667                 786 bp    mRNA    linear   HUM 29-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0727D for
            gene C12orf8, chromosome 12 open reading frame 8; complete cds,
            incl. stopcodon.
ACCESSION   CR541667
VERSION     CR541667.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 786)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 786)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0727D, ORFNo 3284
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0727D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_006817 (GI:13124889)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..786
                     /db_xref="H-InvDB:HIT000268540"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0727D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..786
                     /codon_start=1
                     /gene="C12orf8"
                     /db_xref="GOA:P30040"
                     /db_xref="H-InvDB:HIT000268540.12"
                     /db_xref="HGNC:HGNC:13799"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR012883"
                     /db_xref="InterPro:IPR016855"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR036356"
                     /db_xref="PDB:2QC7"
                     /db_xref="PDB:5V8Z"
                     /db_xref="PDB:5V90"
                     /db_xref="UniProtKB/Swiss-Prot:P30040"
                     /protein_id="CAG46468.1"
                     /translation="MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTV
                     TFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM
                     ELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPV
                     YDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPA
                     SEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL"
BASE COUNT          187 a          205 c          236 g          158 t
ORIGIN      
        1 atggctgccg ctgtgccccg cgccgcattt ctctccccgc tgcttcccct tctcctgggc
       61 ttcctgctcc tctccgctcc gcatggcggc agcggcctgc acaccaaggg cgcccttccc
      121 ctggatacgg tcactttcta caaggtcatt cccaaaagca agttcgtctt ggtgaagttc
      181 gacacccagt acccctacgg tgagaagcag gatgagttca agcgtcttgc tgaaaactcg
      241 gcttccagcg atgatctctt ggtggcagag gtggggatct cagattatgg tgacaagctg
      301 aacatggagc tgagtgagaa atacaagctg gacaaagaga gctacccagt cttctacctc
      361 ttccgggatg gggactttga gaacccagtc ccatacactg gggcagttaa ggttggagcc
      421 atccagcgct ggttgaaggg gcaaggggtc tacctaggta tgcctggttg cctgcctgta
      481 tacgatgccc tggccgggga gttcatcagg gcctctggtg tggaggcccg ccaggccctc
      541 ttgaagcagg ggcaagataa cctctcaagt gtgaaggaga ctcagaagaa gtgggccgag
      601 caatacctga agatcatggg gaagatctta gaccaagggg aggacttccc agcatcagag
      661 atgacacgga tcgccaggct gattgagaag aacaagatga gtgacgggaa gaaggaggag
      721 ctccagaaga gcttaaacat cctgactgcc ttccagaaga agggggccga gaaagaggag
      781 ctgtaa
//