LOCUS CR541667 786 bp mRNA linear HUM 29-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0727D for gene C12orf8, chromosome 12 open reading frame 8; complete cds, incl. stopcodon. ACCESSION CR541667 VERSION CR541667.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 786) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 786) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0727D, ORFNo 3284 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0727D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_006817 (GI:13124889) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..786 /db_xref="H-InvDB:HIT000268540" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0727D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..786 /codon_start=1 /gene="C12orf8" /db_xref="GOA:P30040" /db_xref="H-InvDB:HIT000268540.12" /db_xref="HGNC:HGNC:13799" /db_xref="InterPro:IPR011679" /db_xref="InterPro:IPR012883" /db_xref="InterPro:IPR016855" /db_xref="InterPro:IPR036249" /db_xref="InterPro:IPR036356" /db_xref="PDB:2QC7" /db_xref="PDB:5V8Z" /db_xref="PDB:5V90" /db_xref="UniProtKB/Swiss-Prot:P30040" /protein_id="CAG46468.1" /translation="MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTV TFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM ELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPV YDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPA SEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL" BASE COUNT 187 a 205 c 236 g 158 t ORIGIN 1 atggctgccg ctgtgccccg cgccgcattt ctctccccgc tgcttcccct tctcctgggc 61 ttcctgctcc tctccgctcc gcatggcggc agcggcctgc acaccaaggg cgcccttccc 121 ctggatacgg tcactttcta caaggtcatt cccaaaagca agttcgtctt ggtgaagttc 181 gacacccagt acccctacgg tgagaagcag gatgagttca agcgtcttgc tgaaaactcg 241 gcttccagcg atgatctctt ggtggcagag gtggggatct cagattatgg tgacaagctg 301 aacatggagc tgagtgagaa atacaagctg gacaaagaga gctacccagt cttctacctc 361 ttccgggatg gggactttga gaacccagtc ccatacactg gggcagttaa ggttggagcc 421 atccagcgct ggttgaaggg gcaaggggtc tacctaggta tgcctggttg cctgcctgta 481 tacgatgccc tggccgggga gttcatcagg gcctctggtg tggaggcccg ccaggccctc 541 ttgaagcagg ggcaagataa cctctcaagt gtgaaggaga ctcagaagaa gtgggccgag 601 caatacctga agatcatggg gaagatctta gaccaagggg aggacttccc agcatcagag 661 atgacacgga tcgccaggct gattgagaag aacaagatga gtgacgggaa gaaggaggag 721 ctccagaaga gcttaaacat cctgactgcc ttccagaaga agggggccga gaaagaggag 781 ctgtaa //