LOCUS CR541663 606 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0227D for gene RNP24, coated vesicle membrane protein; complete cds, incl. stopcodon. ACCESSION CR541663 VERSION CR541663.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 606) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 606) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0227D, ORFNo 3266 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0227D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu): FLH131065.01X This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_006815 (GI:21314646) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..606 /db_xref="H-InvDB:HIT000268536" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0227D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..606 /codon_start=1 /gene="RNP24" /db_xref="GOA:Q6FHT8" /db_xref="H-InvDB:HIT000268536.13" /db_xref="InterPro:IPR009038" /db_xref="InterPro:IPR015720" /db_xref="InterPro:IPR036598" /db_xref="UniProtKB/TrEMBL:Q6FHT8" /protein_id="CAG46464.1" /translation="MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMG LIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMT PKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRA INDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV" BASE COUNT 176 a 131 c 160 g 139 t ORIGIN 1 atggtgacgc ttgctgaact gctggtgctc ctggccgctc tcctggccac ggtctcgggc 61 tatttcgtta gcatcgacgc ccatgctgaa gagtgcttct ttgagcgggt cacctcgggc 121 accaagatgg gcctcatctt cgaggtggcg gagggcggct tcctggacat cgacgtggag 181 attacaggac cagataacaa aggaatttac aaaggagaca gagaatccag tgggaaatac 241 acatttgctg ctcacatgga tggaacatac aaattttgtt ttagtaaccg gatgtccacc 301 atgactccaa aaatagtgat gttcaccatt gatattgggg aggctccaaa aggacaagat 361 atggaaacag aagctcacca gaacaagcta gaagaaatga tcaatgagct agcagtggcg 421 atgacagctg taaagcacga acaggaatac atggaagtcc gggagagaat acacagagcc 481 atcaacgaca acacaaacag cagagtggtc ctttggtcct tctttgaagc tcttgttcta 541 gttgccatga cattgggaca gatctactac ctgaagagat tttttgaagt ccggagagtt 601 gtttaa //