LOCUS CR536570 1248 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A1122D for gene PCOLCE2, procollagen C-endopeptidase enhancer 2; complete cds, incl. stopcodon. ACCESSION CR536570 VERSION CR536570.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1248) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1248) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A1122D, ORFNo 3181 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1122D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_013363 (gi16904386) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1248 /db_xref="H-InvDB:HIT000268506" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A1122D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1248 /codon_start=1 /gene="PCOLCE2" /db_xref="GOA:Q9UKZ9" /db_xref="H-InvDB:HIT000268506.14" /db_xref="HGNC:HGNC:8739" /db_xref="InterPro:IPR000859" /db_xref="InterPro:IPR001134" /db_xref="InterPro:IPR008993" /db_xref="InterPro:IPR018933" /db_xref="InterPro:IPR035814" /db_xref="InterPro:IPR035914" /db_xref="UniProtKB/Swiss-Prot:Q9UKZ9" /protein_id="CAG38807.1" /translation="MRGANAWAPLCLLLAAATQLSRQQSPERPVFTCGGILTGESGFI GSEGFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQR IGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMAMFSAAEPNERGDQYCGGLLDR PSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERDNYCRYDYVAVFNG GEVNDARRIGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFRPKKLPTTT EQPVTTTFPVTTGLKPTVALCQQKCRRTGTLEGNYCSSDFVLAGTVITTITRDGSLHA TVSIINIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMP NSFIMMFKTKNQKLLDALKNKQC" BASE COUNT 333 a 287 c 315 g 313 t ORIGIN 1 atgaggggcg cgaacgcctg ggcgccactc tgcctgctgc tggctgccgc cacccagctc 61 tcgcggcagc agtccccaga gagacctgtt ttcacatgtg gtggcattct tactggagag 121 tctggattta ttggcagtga aggttttcct ggagtgtacc ctccaaatag caaatgtact 181 tggaaaatca cagttcccga aggaaaagta gtcgttctca atttccgatt catagacctc 241 gagagtgaca acctgtgccg ctatgacttt gtggatgtgt acaatggcca tgccaatggc 301 cagcgcattg gccgcttctg tggcactttc cggcctggag cccttgtgtc cagtggcaac 361 aagatgatgg tgcagatgat ttctgatgcc aacacagctg gcaatggctt catggccatg 421 ttctccgctg ctgaaccaaa cgaaagaggg gatcagtatt gtggaggact ccttgacaga 481 ccttccggct cttttaaaac ccccaactgg ccagaccggg attaccctgc aggagtcact 541 tgtgtgtggc acattgtagc cccaaagaat cagcttatag aattaaagtt tgagaagttt 601 gatgtggagc gagataacta ctgccgatat gattatgtgg ctgtgtttaa tggcggggaa 661 gtcaacgatg ctagaagaat tggaaagtat tgtggtgata gtccacctgc gccaattgtg 721 tctgagagaa atgaacttct tattcagttt ttatcagact taagtttaac tgcagatggg 781 tttattggtc actacatatt caggccaaaa aaactgccta caactacaga acagcctgtc 841 accaccacat tccctgtaac cacgggttta aaacccaccg tggccttgtg tcaacaaaag 901 tgtagacgga cggggactct ggagggcaat tattgttcaa gtgactttgt attagccggc 961 actgttatca caaccatcac tcgcgatggg agtttgcacg ccacagtctc gatcatcaac 1021 atctacaaag agggaaattt ggcgattcag caggcgggca agaacatgag tgccaggctg 1081 actgtcgtct gcaagcagtg ccctctcctc agaagaggtc taaattacat tattatgggc 1141 caagtaggtg aagatgggcg aggcaaaatc atgccaaaca gctttatcat gatgttcaag 1201 accaagaatc agaagctcct ggatgcctta aaaaataagc aatgttaa //