LOCUS       CR536570                1248 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A1122D for
            gene PCOLCE2, procollagen C-endopeptidase enhancer 2; complete cds,
            incl. stopcodon.
ACCESSION   CR536570
VERSION     CR536570.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1248)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1248)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A1122D, ORFNo 3181
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1122D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_013363 (gi16904386)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1248
                     /db_xref="H-InvDB:HIT000268506"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A1122D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1248
                     /codon_start=1
                     /gene="PCOLCE2"
                     /db_xref="GOA:Q9UKZ9"
                     /db_xref="H-InvDB:HIT000268506.14"
                     /db_xref="HGNC:HGNC:8739"
                     /db_xref="InterPro:IPR000859"
                     /db_xref="InterPro:IPR001134"
                     /db_xref="InterPro:IPR008993"
                     /db_xref="InterPro:IPR018933"
                     /db_xref="InterPro:IPR035814"
                     /db_xref="InterPro:IPR035914"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UKZ9"
                     /protein_id="CAG38807.1"
                     /translation="MRGANAWAPLCLLLAAATQLSRQQSPERPVFTCGGILTGESGFI
                     GSEGFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQR
                     IGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMAMFSAAEPNERGDQYCGGLLDR
                     PSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERDNYCRYDYVAVFNG
                     GEVNDARRIGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFRPKKLPTTT
                     EQPVTTTFPVTTGLKPTVALCQQKCRRTGTLEGNYCSSDFVLAGTVITTITRDGSLHA
                     TVSIINIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMP
                     NSFIMMFKTKNQKLLDALKNKQC"
BASE COUNT          333 a          287 c          315 g          313 t
ORIGIN      
        1 atgaggggcg cgaacgcctg ggcgccactc tgcctgctgc tggctgccgc cacccagctc
       61 tcgcggcagc agtccccaga gagacctgtt ttcacatgtg gtggcattct tactggagag
      121 tctggattta ttggcagtga aggttttcct ggagtgtacc ctccaaatag caaatgtact
      181 tggaaaatca cagttcccga aggaaaagta gtcgttctca atttccgatt catagacctc
      241 gagagtgaca acctgtgccg ctatgacttt gtggatgtgt acaatggcca tgccaatggc
      301 cagcgcattg gccgcttctg tggcactttc cggcctggag cccttgtgtc cagtggcaac
      361 aagatgatgg tgcagatgat ttctgatgcc aacacagctg gcaatggctt catggccatg
      421 ttctccgctg ctgaaccaaa cgaaagaggg gatcagtatt gtggaggact ccttgacaga
      481 ccttccggct cttttaaaac ccccaactgg ccagaccggg attaccctgc aggagtcact
      541 tgtgtgtggc acattgtagc cccaaagaat cagcttatag aattaaagtt tgagaagttt
      601 gatgtggagc gagataacta ctgccgatat gattatgtgg ctgtgtttaa tggcggggaa
      661 gtcaacgatg ctagaagaat tggaaagtat tgtggtgata gtccacctgc gccaattgtg
      721 tctgagagaa atgaacttct tattcagttt ttatcagact taagtttaac tgcagatggg
      781 tttattggtc actacatatt caggccaaaa aaactgccta caactacaga acagcctgtc
      841 accaccacat tccctgtaac cacgggttta aaacccaccg tggccttgtg tcaacaaaag
      901 tgtagacgga cggggactct ggagggcaat tattgttcaa gtgactttgt attagccggc
      961 actgttatca caaccatcac tcgcgatggg agtttgcacg ccacagtctc gatcatcaac
     1021 atctacaaag agggaaattt ggcgattcag caggcgggca agaacatgag tgccaggctg
     1081 actgtcgtct gcaagcagtg ccctctcctc agaagaggtc taaattacat tattatgggc
     1141 caagtaggtg aagatgggcg aggcaaaatc atgccaaaca gctttatcat gatgttcaag
     1201 accaagaatc agaagctcct ggatgcctta aaaaataagc aatgttaa
//