LOCUS       CR536569                 663 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0622D for
            gene POP4, POP4 (processing of precursor , S. cerevisiae) homolog;
            complete cds, incl. stopcodon.
ACCESSION   CR536569
VERSION     CR536569.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 663)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0622D, ORFNo 3179
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0622D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_006627 (gi5729985)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..663
                     /db_xref="H-InvDB:HIT000268505"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0622D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..663
                     /codon_start=1
                     /gene="POP4"
                     /db_xref="GOA:O95707"
                     /db_xref="H-InvDB:HIT000268505.12"
                     /db_xref="HGNC:HGNC:30081"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="InterPro:IPR036980"
                     /db_xref="PDB:6AHR"
                     /db_xref="PDB:6AHU"
                     /db_xref="UniProtKB/Swiss-Prot:O95707"
                     /protein_id="CAG38806.1"
                     /translation="MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSP
                     QAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPL
                     HELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQE
                     TKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTI
                     DL"
BASE COUNT          188 a          175 c          170 g          130 t
ORIGIN      
        1 atgaagagtg tgatctacca tgcattgtct cagaaagagg cgaatgactc cgatgtccag
       61 ccttcaggag cacagcgggc cgaggccttc gtgagggcct tcctgaagcg cagcacgccc
      121 cgcatgagcc cgcaggcccg cgaggaccag ctgcagcgca aggcggtggt cctggagtac
      181 ttcacccgcc acaagcgcaa ggagaagaag aagaaagcca aaggcctctc tgccaggcaa
      241 aggagggagc tgcggctctt tgacattaaa ccagagcagc agagatacag ccttttcctc
      301 cctctccatg aactctggaa acagtacatc agggacctgt gcagtgggct caagccagac
      361 acgcagccac agatgattca ggccaagctc ttaaaggcag atcttcacgg ggctattatt
      421 tcagtgacaa aatccaaatg cccctcttat gtgggtatta caggaatcct tctacaggaa
      481 acaaagcaca ttttcaaaat tatcaccaaa gaagaccgcc tgaaagttat ccccaagcta
      541 aactgcgtgt tcactgtgga aaccgatggc tttatttcct acatttacgg gagcaaattc
      601 cagcttcggt caagtgaacg gtctgcgaag aagttcaaag cgaagggaac gattgacctg
      661 tga
//