LOCUS CR536569 663 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0622D for gene POP4, POP4 (processing of precursor , S. cerevisiae) homolog; complete cds, incl. stopcodon. ACCESSION CR536569 VERSION CR536569.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 663) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 663) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0622D, ORFNo 3179 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0622D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_006627 (gi5729985) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..663 /db_xref="H-InvDB:HIT000268505" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0622D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..663 /codon_start=1 /gene="POP4" /db_xref="GOA:O95707" /db_xref="H-InvDB:HIT000268505.12" /db_xref="HGNC:HGNC:30081" /db_xref="InterPro:IPR002730" /db_xref="InterPro:IPR016848" /db_xref="InterPro:IPR023534" /db_xref="InterPro:IPR036980" /db_xref="PDB:6AHR" /db_xref="PDB:6AHU" /db_xref="UniProtKB/Swiss-Prot:O95707" /protein_id="CAG38806.1" /translation="MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSP QAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPL HELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQE TKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTI DL" BASE COUNT 188 a 175 c 170 g 130 t ORIGIN 1 atgaagagtg tgatctacca tgcattgtct cagaaagagg cgaatgactc cgatgtccag 61 ccttcaggag cacagcgggc cgaggccttc gtgagggcct tcctgaagcg cagcacgccc 121 cgcatgagcc cgcaggcccg cgaggaccag ctgcagcgca aggcggtggt cctggagtac 181 ttcacccgcc acaagcgcaa ggagaagaag aagaaagcca aaggcctctc tgccaggcaa 241 aggagggagc tgcggctctt tgacattaaa ccagagcagc agagatacag ccttttcctc 301 cctctccatg aactctggaa acagtacatc agggacctgt gcagtgggct caagccagac 361 acgcagccac agatgattca ggccaagctc ttaaaggcag atcttcacgg ggctattatt 421 tcagtgacaa aatccaaatg cccctcttat gtgggtatta caggaatcct tctacaggaa 481 acaaagcaca ttttcaaaat tatcaccaaa gaagaccgcc tgaaagttat ccccaagcta 541 aactgcgtgt tcactgtgga aaccgatggc tttatttcct acatttacgg gagcaaattc 601 cagcttcggt caagtgaacg gtctgcgaag aagttcaaag cgaagggaac gattgacctg 661 tga //