LOCUS CR536562 1143 bp mRNA linear HUM 23-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1220D for gene FEN1, flap structure-specific endonuclease 1; complete cds, incl. stopcodon. ACCESSION CR536562 VERSION CR536562.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1143) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1143) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1220D, ORFNo 3169 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1220D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_004111 (gi19718776) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1143 /db_xref="H-InvDB:HIT000268498" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1220D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1143 /codon_start=1 /gene="FEN1" /db_xref="GOA:Q6FHX6" /db_xref="H-InvDB:HIT000268498.14" /db_xref="InterPro:IPR006084" /db_xref="InterPro:IPR006085" /db_xref="InterPro:IPR006086" /db_xref="InterPro:IPR008918" /db_xref="InterPro:IPR019974" /db_xref="InterPro:IPR023426" /db_xref="InterPro:IPR029060" /db_xref="InterPro:IPR036279" /db_xref="UniProtKB/TrEMBL:Q6FHX6" /protein_id="CAG38799.1" /translation="MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLI AVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSE RRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAE ASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGL NQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLH KEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQG STQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK" BASE COUNT 291 a 283 c 353 g 216 t ORIGIN 1 atgggaattc aaggcctggc caaactaatt gctgatgtgg cccccagtgc catccgggag 61 aatgacatca agagctactt tggccgtaag gtggccattg atgcctctat gagcatttat 121 cagttcctga ttgctgttcg ccagggtggg gatgtgctgc agaatgagga gggtgagacc 181 accagccacc tgatgggcat gttctaccgc accattcgca tgatggagaa cggcatcaag 241 cccgtgtatg tctttgatgg caagccgcca cagctcaagt caggcgagct ggccaaacgc 301 agtgagcggc gggctgaggc agagaagcag ctgcagcagg ctcaggctgc tggggccgag 361 caggaggtgg aaaaattcac taagcggctg gtgaaggtca ctaagcagca caatgatgag 421 tgcaaacatc tgctgagcct catgggcatc ccttatcttg atgcacccag tgaggcagag 481 gccagctgtg ctgccctggt gaaggctggc aaagtctatg ctgcggctac cgaggacatg 541 gactgcctca ccttcggcag ccctgtgcta atgcgacacc tgactgccag tgaagccaaa 601 aagctgccaa tccaggaatt ccacctgagc cggattctgc aggagctggg cctgaaccag 661 gaacagtttg tggatctgtg catcctgcta ggcagtgact actgtgagag tatccggggt 721 attgggccca agcgggctgt ggacctcatc cagaagcaca agagcatcga ggagatcgtg 781 cggcgacttg accccaacaa gtaccctgtg ccagaaaatt ggctccacaa ggaggctcac 841 cagctcttct tggaacctga ggtgctggac ccagagtctg tggagctgaa gtggagcgag 901 ccaaatgaag aagagctgat caagttcatg tgtggtgaaa agcagttctc tgaggagcga 961 atccgcagtg gggtcaagag gctgagtaag agccgccaag gcagcaccca gggccgcctg 1021 gatgatttct tcaaggtgac cggctcactc tcttcagcta agcgcaagga gccagaaccc 1081 aagggatcca ctaagaagaa ggcaaagact ggggcagcag ggaagtttaa aaggggaaaa 1141 taa //