LOCUS       CR536562                1143 bp    mRNA    linear   HUM 23-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H1220D for
            gene FEN1, flap structure-specific endonuclease 1; complete cds,
            incl. stopcodon.
ACCESSION   CR536562
VERSION     CR536562.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1143)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1143)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H1220D, ORFNo 3169
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1220D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_004111 (gi19718776)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1143
                     /db_xref="H-InvDB:HIT000268498"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H1220D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1143
                     /codon_start=1
                     /gene="FEN1"
                     /db_xref="GOA:Q6FHX6"
                     /db_xref="H-InvDB:HIT000268498.14"
                     /db_xref="InterPro:IPR006084"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="InterPro:IPR036279"
                     /db_xref="UniProtKB/TrEMBL:Q6FHX6"
                     /protein_id="CAG38799.1"
                     /translation="MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLI
                     AVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSE
                     RRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAE
                     ASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGL
                     NQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLH
                     KEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQG
                     STQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK"
BASE COUNT          291 a          283 c          353 g          216 t
ORIGIN      
        1 atgggaattc aaggcctggc caaactaatt gctgatgtgg cccccagtgc catccgggag
       61 aatgacatca agagctactt tggccgtaag gtggccattg atgcctctat gagcatttat
      121 cagttcctga ttgctgttcg ccagggtggg gatgtgctgc agaatgagga gggtgagacc
      181 accagccacc tgatgggcat gttctaccgc accattcgca tgatggagaa cggcatcaag
      241 cccgtgtatg tctttgatgg caagccgcca cagctcaagt caggcgagct ggccaaacgc
      301 agtgagcggc gggctgaggc agagaagcag ctgcagcagg ctcaggctgc tggggccgag
      361 caggaggtgg aaaaattcac taagcggctg gtgaaggtca ctaagcagca caatgatgag
      421 tgcaaacatc tgctgagcct catgggcatc ccttatcttg atgcacccag tgaggcagag
      481 gccagctgtg ctgccctggt gaaggctggc aaagtctatg ctgcggctac cgaggacatg
      541 gactgcctca ccttcggcag ccctgtgcta atgcgacacc tgactgccag tgaagccaaa
      601 aagctgccaa tccaggaatt ccacctgagc cggattctgc aggagctggg cctgaaccag
      661 gaacagtttg tggatctgtg catcctgcta ggcagtgact actgtgagag tatccggggt
      721 attgggccca agcgggctgt ggacctcatc cagaagcaca agagcatcga ggagatcgtg
      781 cggcgacttg accccaacaa gtaccctgtg ccagaaaatt ggctccacaa ggaggctcac
      841 cagctcttct tggaacctga ggtgctggac ccagagtctg tggagctgaa gtggagcgag
      901 ccaaatgaag aagagctgat caagttcatg tgtggtgaaa agcagttctc tgaggagcga
      961 atccgcagtg gggtcaagag gctgagtaag agccgccaag gcagcaccca gggccgcctg
     1021 gatgatttct tcaaggtgac cggctcactc tcttcagcta agcgcaagga gccagaaccc
     1081 aagggatcca ctaagaagaa ggcaaagact ggggcagcag ggaagtttaa aaggggaaaa
     1141 taa
//