LOCUS CR536560 1053 bp mRNA linear HUM 23-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E1220D for gene RAD51L1, RAD51-like 1 (S. cerevisiae); complete cds, incl. stopcodon. ACCESSION CR536560 VERSION CR536560.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1053) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1053) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E1220D, ORFNo 3166 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1220D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_002877 (gi21396491) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1053 /db_xref="H-InvDB:HIT000268496" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E1220D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1053 /codon_start=1 /gene="RAD51L1" /db_xref="GOA:O15315" /db_xref="H-InvDB:HIT000268496.12" /db_xref="HGNC:HGNC:9822" /db_xref="InterPro:IPR003593" /db_xref="InterPro:IPR013632" /db_xref="InterPro:IPR016467" /db_xref="InterPro:IPR020588" /db_xref="InterPro:IPR027417" /db_xref="InterPro:IPR030548" /db_xref="InterPro:IPR033925" /db_xref="UniProtKB/Swiss-Prot:O15315" /protein_id="CAG38797.1" /translation="MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGL SYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGS LTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRF PRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRK EFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSP ADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFV YTIKEEGLVLQAYGNS" BASE COUNT 285 a 224 c 246 g 298 t ORIGIN 1 atgggtagca agaaactaaa acgagtgggt ttatcacaag agctgtgtga ccgtctgagt 61 agacatcaga tccttacctg tcaggacttt ttatgtcttt ccccactgga gcttatgaag 121 gtgactggtc tgagttatcg aggtgtccat gaacttctat gtatggtcag cagggcctgt 181 gccccaaaga tgcaaacggc ttatgggata aaagcacaaa ggtctgctga tttctcacca 241 gcattcttat ctactaccct ttctgctttg gacgaagccc tgcatggtgg tgtggcttgt 301 ggatccctca cagagattac aggtccacca ggttgtggaa aaactcagtt ttgtataatg 361 atgagcattt tggctacatt acccaccaac atgggaggat tagaaggagc tgtggtgtac 421 attgacacag agtctgcatt tagtgctgaa agactggttg aaatagcaga atcccgtttt 481 cccagatatt ttaacactga agaaaagtta cttttgacaa gtagtaaagt tcatctttat 541 cgggaactca cctgtgatga agttctacaa aggattgaat ctttggaaga agaaattatc 601 tcaaaaggaa ttaaacttgt gattcttgac tctgttgctt ctgtggtcag aaaggagttt 661 gatgcacaac ttcaaggcaa tctcaaagaa agaaacaagt tcttggcaag agaggcatcc 721 tccttgaagt atttggctga ggagttttca atcccagtta tcttgacgaa tcagattaca 781 acccatctga gtggagccct ggcttctcag gcagacctgg tgtctccagc tgatgatttg 841 tccctgtctg aaggcacttc tggatccagc tgtgtgatag ccgcactagg aaatacctgg 901 agtcacagtg tgaatacccg gctgatcctc cagtaccttg attcagagag aagacagatt 961 cttattgcca agtcccctct ggctcccttc acctcatttg tctacaccat caaggaggaa 1021 ggcctggttc ttcaagccta tggaaattcc tag //