LOCUS       CR536560                1053 bp    mRNA    linear   HUM 23-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E1220D for
            gene RAD51L1, RAD51-like 1 (S. cerevisiae); complete cds, incl.
            stopcodon.
ACCESSION   CR536560
VERSION     CR536560.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1053)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1053)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E1220D, ORFNo 3166
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1220D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_002877 (gi21396491)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1053
                     /db_xref="H-InvDB:HIT000268496"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E1220D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1053
                     /codon_start=1
                     /gene="RAD51L1"
                     /db_xref="GOA:O15315"
                     /db_xref="H-InvDB:HIT000268496.12"
                     /db_xref="HGNC:HGNC:9822"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030548"
                     /db_xref="InterPro:IPR033925"
                     /db_xref="UniProtKB/Swiss-Prot:O15315"
                     /protein_id="CAG38797.1"
                     /translation="MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGL
                     SYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGS
                     LTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRF
                     PRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRK
                     EFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSP
                     ADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFV
                     YTIKEEGLVLQAYGNS"
BASE COUNT          285 a          224 c          246 g          298 t
ORIGIN      
        1 atgggtagca agaaactaaa acgagtgggt ttatcacaag agctgtgtga ccgtctgagt
       61 agacatcaga tccttacctg tcaggacttt ttatgtcttt ccccactgga gcttatgaag
      121 gtgactggtc tgagttatcg aggtgtccat gaacttctat gtatggtcag cagggcctgt
      181 gccccaaaga tgcaaacggc ttatgggata aaagcacaaa ggtctgctga tttctcacca
      241 gcattcttat ctactaccct ttctgctttg gacgaagccc tgcatggtgg tgtggcttgt
      301 ggatccctca cagagattac aggtccacca ggttgtggaa aaactcagtt ttgtataatg
      361 atgagcattt tggctacatt acccaccaac atgggaggat tagaaggagc tgtggtgtac
      421 attgacacag agtctgcatt tagtgctgaa agactggttg aaatagcaga atcccgtttt
      481 cccagatatt ttaacactga agaaaagtta cttttgacaa gtagtaaagt tcatctttat
      541 cgggaactca cctgtgatga agttctacaa aggattgaat ctttggaaga agaaattatc
      601 tcaaaaggaa ttaaacttgt gattcttgac tctgttgctt ctgtggtcag aaaggagttt
      661 gatgcacaac ttcaaggcaa tctcaaagaa agaaacaagt tcttggcaag agaggcatcc
      721 tccttgaagt atttggctga ggagttttca atcccagtta tcttgacgaa tcagattaca
      781 acccatctga gtggagccct ggcttctcag gcagacctgg tgtctccagc tgatgatttg
      841 tccctgtctg aaggcacttc tggatccagc tgtgtgatag ccgcactagg aaatacctgg
      901 agtcacagtg tgaatacccg gctgatcctc cagtaccttg attcagagag aagacagatt
      961 cttattgcca agtcccctct ggctcccttc acctcatttg tctacaccat caaggaggaa
     1021 ggcctggttc ttcaagccta tggaaattcc tag
//