LOCUS CR536556 957 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E1120D for gene DEDD, death effector domain containing; complete cds, incl. stopcodon. ACCESSION CR536556 VERSION CR536556.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 957) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 957) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E1120D, ORFNo 3158 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1120D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_032998 (gi14670393) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..957 /db_xref="H-InvDB:HIT000268492" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E1120D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..957 /codon_start=1 /gene="DEDD" /db_xref="GOA:O75618" /db_xref="H-InvDB:HIT000268492.13" /db_xref="HGNC:HGNC:2755" /db_xref="InterPro:IPR001875" /db_xref="InterPro:IPR011029" /db_xref="InterPro:IPR038856" /db_xref="UniProtKB/Swiss-Prot:O75618" /protein_id="CAG38793.1" /translation="MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRV LSFLFVDVIDDHERGLIRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVT LKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQ MCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNK QDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVF ITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP" BASE COUNT 226 a 270 c 258 g 203 t ORIGIN 1 atggcgggcc taaagcggcg ggcaagccag gtgtggccag aagagcatgg tgagcaggaa 61 catgggctgt acagcctgca ccgcatgttt gacatcgtgg gcactcatct gacacacaga 121 gatgtgcgcg tgctttcttt cctctttgtt gatgtcattg atgaccacga gcgtggactc 181 atccgaaatg gacgtgactt cttattggca ctggagcgcc agggccgctg tgatgaaagt 241 aactttcgcc aggtgctgca gctgctgcgc atcatcactc gccacgacct gctgccctac 301 gtcaccctca agaggagacg ggctgtgtgc cctgatcttg tagacaagta tctggaggag 361 acatcaattc gctatgtgac ccccagagcc ctcagtgatc cagaaccaag gcctccccag 421 ccctctaaaa cagtgcctcc ccactatcct gtggtgtgtt gccccacttc gggtcctcag 481 atgtgtagca agcggccagc ccgagggaga gccacacttg ggagccagcg aaaacgccgg 541 aagtcagtga caccagatcc caaggagaag cagacatgtg acatcagact gcgggttcgg 601 gctgaatact gccagcatga gactgctctg cagggcaatg tcttctctaa caagcaggac 661 ccacttgagc gccagtttga gcgctttaac caggccaaca ccatcctcaa gtcccgggac 721 ctgggctcca tcatctgtga catcaagttc tctgagctca cctacctcga tgcattctgg 781 cgtgactaca tcaatggctc tttattagag gcacttaaag gtgtcttcat cacagactcc 841 ctcaagcaag ctgtgggcca tgaagccatc aagctgctgg taaatgtaga cgaggaggac 901 tatgagctgg gccgacagaa actcctgagg aacttgatgc tgcaagcatt gccctga //