LOCUS       CR536556                 957 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E1120D for
            gene DEDD, death effector domain containing; complete cds, incl.
            stopcodon.
ACCESSION   CR536556
VERSION     CR536556.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 957)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 957)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E1120D, ORFNo 3158
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1120D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_032998 (gi14670393)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..957
                     /db_xref="H-InvDB:HIT000268492"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E1120D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..957
                     /codon_start=1
                     /gene="DEDD"
                     /db_xref="GOA:O75618"
                     /db_xref="H-InvDB:HIT000268492.13"
                     /db_xref="HGNC:HGNC:2755"
                     /db_xref="InterPro:IPR001875"
                     /db_xref="InterPro:IPR011029"
                     /db_xref="InterPro:IPR038856"
                     /db_xref="UniProtKB/Swiss-Prot:O75618"
                     /protein_id="CAG38793.1"
                     /translation="MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRV
                     LSFLFVDVIDDHERGLIRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVT
                     LKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQ
                     MCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNK
                     QDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVF
                     ITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP"
BASE COUNT          226 a          270 c          258 g          203 t
ORIGIN      
        1 atggcgggcc taaagcggcg ggcaagccag gtgtggccag aagagcatgg tgagcaggaa
       61 catgggctgt acagcctgca ccgcatgttt gacatcgtgg gcactcatct gacacacaga
      121 gatgtgcgcg tgctttcttt cctctttgtt gatgtcattg atgaccacga gcgtggactc
      181 atccgaaatg gacgtgactt cttattggca ctggagcgcc agggccgctg tgatgaaagt
      241 aactttcgcc aggtgctgca gctgctgcgc atcatcactc gccacgacct gctgccctac
      301 gtcaccctca agaggagacg ggctgtgtgc cctgatcttg tagacaagta tctggaggag
      361 acatcaattc gctatgtgac ccccagagcc ctcagtgatc cagaaccaag gcctccccag
      421 ccctctaaaa cagtgcctcc ccactatcct gtggtgtgtt gccccacttc gggtcctcag
      481 atgtgtagca agcggccagc ccgagggaga gccacacttg ggagccagcg aaaacgccgg
      541 aagtcagtga caccagatcc caaggagaag cagacatgtg acatcagact gcgggttcgg
      601 gctgaatact gccagcatga gactgctctg cagggcaatg tcttctctaa caagcaggac
      661 ccacttgagc gccagtttga gcgctttaac caggccaaca ccatcctcaa gtcccgggac
      721 ctgggctcca tcatctgtga catcaagttc tctgagctca cctacctcga tgcattctgg
      781 cgtgactaca tcaatggctc tttattagag gcacttaaag gtgtcttcat cacagactcc
      841 ctcaagcaag ctgtgggcca tgaagccatc aagctgctgg taaatgtaga cgaggaggac
      901 tatgagctgg gccgacagaa actcctgagg aacttgatgc tgcaagcatt gccctga
//