LOCUS CR536544 972 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0720D for gene LGALS4, lectin, galactoside-binding, soluble, 4 (galectin 4); complete cds, incl. stopcodon. ACCESSION CR536544 VERSION CR536544.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 972) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 972) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0720D, ORFNo 3138 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0720D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_006149 (gi6006017) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..972 /db_xref="H-InvDB:HIT000268480" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0720D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..972 /codon_start=1 /gene="LGALS4" /db_xref="GOA:Q6FHZ4" /db_xref="H-InvDB:HIT000268480.11" /db_xref="InterPro:IPR001079" /db_xref="InterPro:IPR013320" /db_xref="InterPro:IPR015533" /db_xref="UniProtKB/TrEMBL:Q6FHZ4" /protein_id="CAG38781.1" /translation="MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMK RFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFE LVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGP PMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTG KSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDL SIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI" BASE COUNT 212 a 292 c 262 g 206 t ORIGIN 1 atggcctatg tccccgcacc gggctaccag cccacctaca acccgacgct gccttactac 61 cagcccatcc cgggcgggct caacgtggga atgtctgttt acatccaagg agtggccagc 121 gagcacatga agcggttctt cgtgaacttt gtggttgggc aggatccggg ctcagacgtc 181 gccttccact tcaatccgcg gtttgacggc tgggacaagg tggtcttcaa cacgttgcag 241 ggcgggaagt ggggcagcga ggagaggaag aggagcatgc ccttcaaaaa gggtgccgcc 301 tttgagctgg tcttcatagt cctggctgag cactacaagg tggtggtaaa tggaaatccc 361 ttctatgagt acgggcaccg gcttccccta cagatggtca cccacctgca agtggatggg 421 gatctgcaac ttcaatcaat caacttcatc ggaggccagc ccctccggcc ccagggaccc 481 ccgatgatgc caccttaccc tggtcccgga cattgccatc aacagctgaa cagcctgccc 541 accatggaag gacccccaac cttcaacccg cctgtgccat atttcgggag gctgcaagga 601 gggctcacag ctcgaagaac catcatcatc aagggctatg tgcctcccac aggcaagagc 661 tttgctatca acttcaaggt gggctcctca ggggacatag ctctgcacat taatccccgc 721 atgggcaacg gtaccgtggt ccggaacagc cttctgaatg gctcgtgggg atccgaggag 781 aagaagatca cccacaaccc atttggtccc ggacagttct ttgatctgtc cattcgctgt 841 ggcttggatc gcttcaaggt ttacgccaat ggccagcacc tctttgactt tgcccatcgc 901 ctctcggcct tccagagggt ggacacattg gaaatccagg gtgatgtcac cttgtcctat 961 gtccagatct aa //