LOCUS       CR536529                 417 bp    mRNA    linear   HUM 23-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0422D for
            gene CDKN2B, cyclin-dependent kinase inhibitor 2B (p15, inhibits
            CDK4); complete cds, incl. stopcodon.
ACCESSION   CR536529
VERSION     CR536529.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 417)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 417)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0422D, ORFNo 3105
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0422D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_004936 (gi17981693)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..417
                     /db_xref="H-InvDB:HIT000268465"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0422D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..417
                     /codon_start=1
                     /gene="CDKN2B"
                     /db_xref="GOA:P42772"
                     /db_xref="H-InvDB:HIT000268465.13"
                     /db_xref="HGNC:HGNC:1788"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="UniProtKB/Swiss-Prot:P42772"
                     /protein_id="CAG38766.1"
                     /translation="MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVN
                     RFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA
                     GARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD"
BASE COUNT           65 a          128 c          168 g           56 t
ORIGIN      
        1 atgcgcgagg agaacaaggg catgcccagt gggggcggca gcgatgaggg tctggccagc
       61 gccgcggcgc ggggactagt ggagaaggtg cgacagctcc tggaagccgg cgcggatccc
      121 aacggagtca accgtttcgg gaggcgcgcg atccaggtca tgatgatggg cagcgcccgc
      181 gtggcggagc tgctgctgct ccacggcgcg gagcccaact gcgcagaccc tgccactctc
      241 acccgaccgg tgcatgatgc tgcccgggag ggcttcctgg acacgctggt ggtgctgcac
      301 cgggccgggg cgcggctgga cgtgcgcgat gcctggggtc gtctgcccgt ggacttggcc
      361 gaggagcggg gccaccgcga cgttgcaggg tacctgcgca cagccacggg ggactga
//