LOCUS CR536529 417 bp mRNA linear HUM 23-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0422D for gene CDKN2B, cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); complete cds, incl. stopcodon. ACCESSION CR536529 VERSION CR536529.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 417) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 417) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0422D, ORFNo 3105 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0422D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_004936 (gi17981693) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..417 /db_xref="H-InvDB:HIT000268465" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0422D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..417 /codon_start=1 /gene="CDKN2B" /db_xref="GOA:P42772" /db_xref="H-InvDB:HIT000268465.13" /db_xref="HGNC:HGNC:1788" /db_xref="InterPro:IPR020683" /db_xref="InterPro:IPR036770" /db_xref="UniProtKB/Swiss-Prot:P42772" /protein_id="CAG38766.1" /translation="MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVN RFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD" BASE COUNT 65 a 128 c 168 g 56 t ORIGIN 1 atgcgcgagg agaacaaggg catgcccagt gggggcggca gcgatgaggg tctggccagc 61 gccgcggcgc ggggactagt ggagaaggtg cgacagctcc tggaagccgg cgcggatccc 121 aacggagtca accgtttcgg gaggcgcgcg atccaggtca tgatgatggg cagcgcccgc 181 gtggcggagc tgctgctgct ccacggcgcg gagcccaact gcgcagaccc tgccactctc 241 acccgaccgg tgcatgatgc tgcccgggag ggcttcctgg acacgctggt ggtgctgcac 301 cgggccgggg cgcggctgga cgtgcgcgat gcctggggtc gtctgcccgt ggacttggcc 361 gaggagcggg gccaccgcga cgttgcaggg tacctgcgca cagccacggg ggactga //