LOCUS       CR536525                 393 bp    mRNA    linear   HUM 23-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G0422D for
            gene HIST2H2AA, histone 2, H2aa; complete cds, incl. stopcodon.
ACCESSION   CR536525
VERSION     CR536525.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 393)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 393)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G0422D, ORFNo 3098
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0422D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_003516 (gi21328454)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..393
                     /db_xref="H-InvDB:HIT000268461_04"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G0422D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..393
                     /codon_start=1
                     /gene="HIST2H2AA"
                     /db_xref="GOA:Q6FI13"
                     /db_xref="H-InvDB:HIT000268461_03.4"
                     /db_xref="HGNC:HGNC:29668"
                     /db_xref="HGNC:HGNC:4736"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR032454"
                     /db_xref="InterPro:IPR032458"
                     /db_xref="UniProtKB/Swiss-Prot:Q6FI13"
                     /protein_id="CAG38762.1"
                     /translation="MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERV
                     GAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVT
                     IAQGGVLPNIQAVLLPKKTESHHKAKGK"
BASE COUNT           85 a          125 c          126 g           57 t
ORIGIN      
        1 atgtctggtc gtggcaagca aggaggcaag gcccgcgcca aggccaagtc gcgctcgtcc
       61 cgcgctggcc ttcagttccc ggtagggcga gtgcatcgct tgctgcgcaa aggcaactac
      121 gcggagcgag tgggggccgg cgcgcccgtc tacatggctg cggtcctcga gtatctgacc
      181 gccgagatcc tggagctggc gggcaacgcg gctcgggaca acaagaagac gcgcatcatc
      241 cctcgtcacc tccagctggc catccgcaac gacgaggaac tgaacaagct gctgggcaaa
      301 gtcaccatcg cccagggcgg cgtcttgcct aacatccagg ccgtactgct ccctaagaag
      361 acggagagtc accacaaggc aaagggcaag tga
//