LOCUS CR536525 393 bp mRNA linear HUM 23-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G0422D for gene HIST2H2AA, histone 2, H2aa; complete cds, incl. stopcodon. ACCESSION CR536525 VERSION CR536525.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 393) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 393) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G0422D, ORFNo 3098 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G0422D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_003516 (gi21328454) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..393 /db_xref="H-InvDB:HIT000268461_04" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G0422D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..393 /codon_start=1 /gene="HIST2H2AA" /db_xref="GOA:Q6FI13" /db_xref="H-InvDB:HIT000268461_03.4" /db_xref="HGNC:HGNC:29668" /db_xref="HGNC:HGNC:4736" /db_xref="InterPro:IPR002119" /db_xref="InterPro:IPR007125" /db_xref="InterPro:IPR009072" /db_xref="InterPro:IPR032454" /db_xref="InterPro:IPR032458" /db_xref="UniProtKB/Swiss-Prot:Q6FI13" /protein_id="CAG38762.1" /translation="MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERV GAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVT IAQGGVLPNIQAVLLPKKTESHHKAKGK" BASE COUNT 85 a 125 c 126 g 57 t ORIGIN 1 atgtctggtc gtggcaagca aggaggcaag gcccgcgcca aggccaagtc gcgctcgtcc 61 cgcgctggcc ttcagttccc ggtagggcga gtgcatcgct tgctgcgcaa aggcaactac 121 gcggagcgag tgggggccgg cgcgcccgtc tacatggctg cggtcctcga gtatctgacc 181 gccgagatcc tggagctggc gggcaacgcg gctcgggaca acaagaagac gcgcatcatc 241 cctcgtcacc tccagctggc catccgcaac gacgaggaac tgaacaagct gctgggcaaa 301 gtcaccatcg cccagggcgg cgtcttgcct aacatccagg ccgtactgct ccctaagaag 361 acggagagtc accacaaggc aaagggcaag tga //