LOCUS CR536524 993 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0120D for gene GRAP2, GRB2-related adaptor protein 2; complete cds, incl. stopcodon. ACCESSION CR536524 VERSION CR536524.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 993) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 993) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0120D, ORFNo 3096 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0120D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_004810 (gi19913386) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..993 /db_xref="H-InvDB:HIT000268460" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0120D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..993 /codon_start=1 /gene="GRAP2" /db_xref="H-InvDB:HIT000268460.13" /db_xref="InterPro:IPR000980" /db_xref="InterPro:IPR001452" /db_xref="InterPro:IPR035646" /db_xref="InterPro:IPR036028" /db_xref="InterPro:IPR036860" /db_xref="UniProtKB/TrEMBL:Q6FI14" /protein_id="CAG38761.1" /translation="MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEG YVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDV QHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSL DRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPP QQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWA RALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR" BASE COUNT 246 a 281 c 279 g 187 t ORIGIN 1 atggaagctg ttgccaagtt tgatttcact gcttcaggtg aggatgaact gagctttcac 61 actggagatg ttttgaagat tttaagtaac caagaggagt ggtttaaggc ggagcttggg 121 agccaggaag gatatgtgcc caagaatttc atagacatcc agtttcccaa atggtttcac 181 gaaggcctct ctcgacacca ggcagagaac ttactcatgg gcaaggaggt tggcttcttc 241 atcatccggg ccagccagag ctccccaggg gacttctcca tctctgtcag gcatgaggat 301 gacgttcaac acttcaaggt catgcgagac aacaagggta attactttct gtggactgag 361 aagtttccat ccctaaataa gctggtagac tactacagga caaattccat ctccagacag 421 aagcagatct tccttagaga cagaacccga gaagaccagg gtcaccgggg caacagcctg 481 gaccggaggt cccagggagg cccacacctc agtggggctg tgggagaaga aatccgacct 541 tcgatgaacc ggaagctgtc ggatcacccc ccgacccttc ccctgcagca gcaccagcac 601 cagccacagc ctccgcaata tgccccagcg ccccagcagc tgcagcagcc cccacagcag 661 cgatatctgc agcaccacca tttccaccag gaacgccgag gaggcagcct tgacataaat 721 gatgggcatt gtggcaccgg cttgggcagt gaaatgaatg cggccctcat gcatcggaga 781 cacacagacc cagtgcagct ccaggcggca gggcgagtgc ggtgggcccg ggcgctgtat 841 gactttgagg ccctggagga tgacgagctg gggttccaca gcggggaggt ggtggaggtc 901 ctggatagct ccaacccatc ctggtggacc ggccgcctgc acaacaagct gggcctcttc 961 cctgccaact acgtggcacc catgacccga taa //