LOCUS CR536496 666 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E1117D for gene RAB27A, RAB27A, member RAS oncogene family; complete cds, incl. stopcodon. ACCESSION CR536496 VERSION CR536496.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 666) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 666) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E1117D, ORFNo 3048 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1117D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_183235 (gi34485708) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..666 /db_xref="H-InvDB:HIT000268434" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E1117D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..666 /codon_start=1 /gene="RAB27A" /db_xref="GOA:P51159" /db_xref="H-InvDB:HIT000268434.12" /db_xref="HGNC:HGNC:9766" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="InterPro:IPR041837" /db_xref="PDB:6HUF" /db_xref="UniProtKB/Swiss-Prot:P51159" /protein_id="CAG38735.1" /translation="MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGI DFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLT NEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYF ETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGA CGC" BASE COUNT 205 a 116 c 185 g 160 t ORIGIN 1 atgtctgatg gagattatga ttacctcatc aagtttttag ctttgggaga ctctggtgta 61 gggaagacca gtgtacttta ccaatataca gatggtaaat ttaactccaa atttatcaca 121 acagtgggca ttgatttcag ggaaaaaaga gtggtgtaca gagccagtgg gccggatgga 181 gccactggca gaggccagag aatccacctg cagttatggg acacagcagg gcaggagagg 241 tttcgtagct taacgacagc gttcttcaga gatgctatgg gttttcttct actttttgat 301 ctgacaaatg agcaaagttt cctcaatgtc agaaactgga taagccagct acagatgcat 361 gcatattgtg aaaacccaga tatagtgctg tgtggaaaca agagtgatct ggaggaccag 421 agagtagtga aagaggagga agccatagca ctcgcagaga aatatggaat cccctacttt 481 gaaactagtg ctgccaatgg gacaaacata agccaagcaa ttgagatgct tctggacctg 541 ataatgaagc gaatggaacg gtgtgtggac aagtcctgga ttcctgaagg agtggtgcga 601 tcaaatggtc atgcctctac ggatcagtta agtgaagaaa aggagaaagg ggcatgtggc 661 tgttga //