LOCUS       CR536496                 666 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E1117D for
            gene RAB27A, RAB27A, member RAS oncogene family; complete cds,
            incl. stopcodon.
ACCESSION   CR536496
VERSION     CR536496.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 666)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 666)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E1117D, ORFNo 3048
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1117D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_183235 (gi34485708)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..666
                     /db_xref="H-InvDB:HIT000268434"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E1117D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..666
                     /codon_start=1
                     /gene="RAB27A"
                     /db_xref="GOA:P51159"
                     /db_xref="H-InvDB:HIT000268434.12"
                     /db_xref="HGNC:HGNC:9766"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR041837"
                     /db_xref="PDB:6HUF"
                     /db_xref="UniProtKB/Swiss-Prot:P51159"
                     /protein_id="CAG38735.1"
                     /translation="MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGI
                     DFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLT
                     NEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYF
                     ETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGA
                     CGC"
BASE COUNT          205 a          116 c          185 g          160 t
ORIGIN      
        1 atgtctgatg gagattatga ttacctcatc aagtttttag ctttgggaga ctctggtgta
       61 gggaagacca gtgtacttta ccaatataca gatggtaaat ttaactccaa atttatcaca
      121 acagtgggca ttgatttcag ggaaaaaaga gtggtgtaca gagccagtgg gccggatgga
      181 gccactggca gaggccagag aatccacctg cagttatggg acacagcagg gcaggagagg
      241 tttcgtagct taacgacagc gttcttcaga gatgctatgg gttttcttct actttttgat
      301 ctgacaaatg agcaaagttt cctcaatgtc agaaactgga taagccagct acagatgcat
      361 gcatattgtg aaaacccaga tatagtgctg tgtggaaaca agagtgatct ggaggaccag
      421 agagtagtga aagaggagga agccatagca ctcgcagaga aatatggaat cccctacttt
      481 gaaactagtg ctgccaatgg gacaaacata agccaagcaa ttgagatgct tctggacctg
      541 ataatgaagc gaatggaacg gtgtgtggac aagtcctgga ttcctgaagg agtggtgcga
      601 tcaaatggtc atgcctctac ggatcagtta agtgaagaaa aggagaaagg ggcatgtggc
      661 tgttga
//