LOCUS       CR536495                 666 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H1017D for
            gene MAD, MAX dimerization protein 1; complete cds, incl.
            stopcodon.
ACCESSION   CR536495
VERSION     CR536495.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 666)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 666)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H1017D, ORFNo 3046
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1017D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_002357 (gi4505068)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..666
                     /db_xref="H-InvDB:HIT000268433"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H1017D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..666
                     /codon_start=1
                     /gene="MAD"
                     /db_xref="GOA:Q05195"
                     /db_xref="H-InvDB:HIT000268433.11"
                     /db_xref="HGNC:HGNC:6761"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR036638"
                     /db_xref="InterPro:IPR040157"
                     /db_xref="PDB:1E91"
                     /db_xref="PDB:1G1E"
                     /db_xref="PDB:1NLW"
                     /db_xref="PDB:1PD7"
                     /db_xref="PDB:1S5Q"
                     /db_xref="UniProtKB/Swiss-Prot:Q05195"
                     /protein_id="CAG38734.1"
                     /translation="MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDAL
                     KRRNKSKKNNSSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAK
                     LHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDRE
                     EIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKAC
                     LGL"
BASE COUNT          201 a          153 c          195 g          117 t
ORIGIN      
        1 atggcggcgg cggttcggat gaacatccag atgctgctgg aggcggccga ctatctggag
       61 cggcgggaga gagaagctga acatggttat gcctccatgt taccatacaa taacaaggac
      121 agagatgcct taaaacggag gaacaaatcc aaaaagaata acagcagtag cagatcaact
      181 cacaatgaaa tggagaagaa tagacgggct catcttcgct tgtgcctgga gaagttgaag
      241 gggctggtgc cacttggacc cgaatcaagt cgacacacta cgttgagttt attaacaaaa
      301 gccaaattgc acataaagaa acttgaagat tgtgacagaa aagccgttca ccaaatcgac
      361 cagcttcagc gagagcagcg acacctgaag aggcagctgg agaagctggg cattgagagg
      421 atccggatgg acagcatcgg ctccaccgtc tcctcggagc gctccgactc cgacagggaa
      481 gaaatcgacg ttgacgtgga gagcacggac tatctcacag gtgatctgga ctggagcagc
      541 agcagtgtga gcgactctga cgagcggggc agcatgcaga gcctcggcag tgatgagggc
      601 tattccagca ccagcatcaa gagaataaag ctgcaggaca gtcacaaggc gtgtcttggt
      661 ctctaa
//