LOCUS CR536495 666 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H1017D for gene MAD, MAX dimerization protein 1; complete cds, incl. stopcodon. ACCESSION CR536495 VERSION CR536495.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 666) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 666) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H1017D, ORFNo 3046 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H1017D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_002357 (gi4505068) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..666 /db_xref="H-InvDB:HIT000268433" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H1017D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..666 /codon_start=1 /gene="MAD" /db_xref="GOA:Q05195" /db_xref="H-InvDB:HIT000268433.11" /db_xref="HGNC:HGNC:6761" /db_xref="InterPro:IPR011598" /db_xref="InterPro:IPR036638" /db_xref="InterPro:IPR040157" /db_xref="PDB:1E91" /db_xref="PDB:1G1E" /db_xref="PDB:1NLW" /db_xref="PDB:1PD7" /db_xref="PDB:1S5Q" /db_xref="UniProtKB/Swiss-Prot:Q05195" /protein_id="CAG38734.1" /translation="MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDAL KRRNKSKKNNSSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAK LHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDRE EIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKAC LGL" BASE COUNT 201 a 153 c 195 g 117 t ORIGIN 1 atggcggcgg cggttcggat gaacatccag atgctgctgg aggcggccga ctatctggag 61 cggcgggaga gagaagctga acatggttat gcctccatgt taccatacaa taacaaggac 121 agagatgcct taaaacggag gaacaaatcc aaaaagaata acagcagtag cagatcaact 181 cacaatgaaa tggagaagaa tagacgggct catcttcgct tgtgcctgga gaagttgaag 241 gggctggtgc cacttggacc cgaatcaagt cgacacacta cgttgagttt attaacaaaa 301 gccaaattgc acataaagaa acttgaagat tgtgacagaa aagccgttca ccaaatcgac 361 cagcttcagc gagagcagcg acacctgaag aggcagctgg agaagctggg cattgagagg 421 atccggatgg acagcatcgg ctccaccgtc tcctcggagc gctccgactc cgacagggaa 481 gaaatcgacg ttgacgtgga gagcacggac tatctcacag gtgatctgga ctggagcagc 541 agcagtgtga gcgactctga cgagcggggc agcatgcaga gcctcggcag tgatgagggc 601 tattccagca ccagcatcaa gagaataaag ctgcaggaca gtcacaaggc gtgtcttggt 661 ctctaa //