LOCUS CR536493 651 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F1017D for gene RAB11A, RAB11A, member RAS oncogene family; complete cds, incl. stopcodon. ACCESSION CR536493 VERSION CR536493.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 651) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 651) AUTHORS Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. JOURNAL Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F1017D, ORFNo 3042 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F1017D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att Compared to the reference sequence NM_004663 (gi34485712) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..651 /db_xref="H-InvDB:HIT000268431" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F1017D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..651 /codon_start=1 /gene="RAB11A" /db_xref="GOA:P62491" /db_xref="H-InvDB:HIT000268431.13" /db_xref="HGNC:HGNC:9760" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="PDB:1OIV" /db_xref="PDB:1OIW" /db_xref="PDB:1OIX" /db_xref="PDB:1YZK" /db_xref="PDB:2D7C" /db_xref="PDB:2GZD" /db_xref="PDB:2GZH" /db_xref="PDB:2HV8" /db_xref="PDB:4C4P" /db_xref="PDB:4D0L" /db_xref="PDB:4D0M" /db_xref="PDB:4LWZ" /db_xref="PDB:4LX0" /db_xref="PDB:4UJ3" /db_xref="PDB:4UJ4" /db_xref="PDB:4UJ5" /db_xref="PDB:5C46" /db_xref="PDB:5C4G" /db_xref="PDB:5EUQ" /db_xref="PDB:5EZ5" /db_xref="PDB:5FBL" /db_xref="PDB:5FBQ" /db_xref="PDB:5FBR" /db_xref="PDB:5FBV" /db_xref="PDB:5FBW" /db_xref="PDB:5JCZ" /db_xref="PDB:6DJL" /db_xref="PDB:6IXV" /db_xref="UniProtKB/Swiss-Prot:P62491" /protein_id="CAG38732.1" /translation="MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTI GVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV ERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTN VEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI" BASE COUNT 210 a 125 c 148 g 168 t ORIGIN 1 atgggcaccc gcgacgacga gtacgactac ctctttaaag ttgtccttat tggagattct 61 ggtgttggaa agagtaatct cctgtctcga tttactcgaa atgagtttaa tctggaaagc 121 aagagcacca ttggagtaga gtttgcaaca agaagcatcc aggttgatgg aaaaacaata 181 aaggcacaga tatgggacac agcagggcaa gagcgatatc gagctataac atcagcatat 241 tatcgtggag ctgtaggtgc cttattggtt tatgacattg ctaaacatct cacatatgaa 301 aatgtagagc gatggctgaa agaactgaga gatcatgctg atagtaacat tgttatcatg 361 cttgtgggca ataagagtga tctacgtcat ctcagggcag ttcctacaga tgaagcaaga 421 gcttttgcag aaaagaatgg tttgtcattc attgaaactt cggccctaga ctctacaaat 481 gtagaagctg cttttcagac aattttaaca gagatttacc gcattgtttc tcagaagcaa 541 atgtcagaca gacgcgaaaa tgacatgtct ccaagcaaca atgtggttcc tattcatgtt 601 ccaccaacca ctgaaaacaa gccaaaggtg cagtgctgtc agaacatcta a //