LOCUS       CR536493                 651 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F1017D for
            gene RAB11A, RAB11A, member RAS oncogene family; complete cds,
            incl. stopcodon.
ACCESSION   CR536493
VERSION     CR536493.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 651)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 651)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F1017D, ORFNo 3042
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F1017D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_004663 (gi34485712)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..651
                     /db_xref="H-InvDB:HIT000268431"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F1017D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..651
                     /codon_start=1
                     /gene="RAB11A"
                     /db_xref="GOA:P62491"
                     /db_xref="H-InvDB:HIT000268431.13"
                     /db_xref="HGNC:HGNC:9760"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:1OIV"
                     /db_xref="PDB:1OIW"
                     /db_xref="PDB:1OIX"
                     /db_xref="PDB:1YZK"
                     /db_xref="PDB:2D7C"
                     /db_xref="PDB:2GZD"
                     /db_xref="PDB:2GZH"
                     /db_xref="PDB:2HV8"
                     /db_xref="PDB:4C4P"
                     /db_xref="PDB:4D0L"
                     /db_xref="PDB:4D0M"
                     /db_xref="PDB:4LWZ"
                     /db_xref="PDB:4LX0"
                     /db_xref="PDB:4UJ3"
                     /db_xref="PDB:4UJ4"
                     /db_xref="PDB:4UJ5"
                     /db_xref="PDB:5C46"
                     /db_xref="PDB:5C4G"
                     /db_xref="PDB:5EUQ"
                     /db_xref="PDB:5EZ5"
                     /db_xref="PDB:5FBL"
                     /db_xref="PDB:5FBQ"
                     /db_xref="PDB:5FBR"
                     /db_xref="PDB:5FBV"
                     /db_xref="PDB:5FBW"
                     /db_xref="PDB:5JCZ"
                     /db_xref="PDB:6DJL"
                     /db_xref="PDB:6IXV"
                     /db_xref="UniProtKB/Swiss-Prot:P62491"
                     /protein_id="CAG38732.1"
                     /translation="MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTI
                     GVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV
                     ERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTN
                     VEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI"
BASE COUNT          210 a          125 c          148 g          168 t
ORIGIN      
        1 atgggcaccc gcgacgacga gtacgactac ctctttaaag ttgtccttat tggagattct
       61 ggtgttggaa agagtaatct cctgtctcga tttactcgaa atgagtttaa tctggaaagc
      121 aagagcacca ttggagtaga gtttgcaaca agaagcatcc aggttgatgg aaaaacaata
      181 aaggcacaga tatgggacac agcagggcaa gagcgatatc gagctataac atcagcatat
      241 tatcgtggag ctgtaggtgc cttattggtt tatgacattg ctaaacatct cacatatgaa
      301 aatgtagagc gatggctgaa agaactgaga gatcatgctg atagtaacat tgttatcatg
      361 cttgtgggca ataagagtga tctacgtcat ctcagggcag ttcctacaga tgaagcaaga
      421 gcttttgcag aaaagaatgg tttgtcattc attgaaactt cggccctaga ctctacaaat
      481 gtagaagctg cttttcagac aattttaaca gagatttacc gcattgtttc tcagaagcaa
      541 atgtcagaca gacgcgaaaa tgacatgtct ccaagcaaca atgtggttcc tattcatgtt
      601 ccaccaacca ctgaaaacaa gccaaaggtg cagtgctgtc agaacatcta a
//