LOCUS CR533524 906 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F1119D for gene C3orf1, chromosome 3 open reading frame 1; complete cds, incl. stopcodon. ACCESSION CR533524 VERSION CR533524.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 858) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 858) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F1119D, ORFNo 2872 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F1119D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence AL136622 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..906 /db_xref="H-InvDB:HIT000268372" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F1119D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..858 /codon_start=1 /gene="C3orf1" /db_xref="GOA:Q9NPL8" /db_xref="H-InvDB:HIT000268372.12" /db_xref="HGNC:HGNC:1321" /db_xref="UniProtKB/Swiss-Prot:Q9NPL8" /protein_id="CAG38555.1" /translation="MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPY VPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQ QYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYR NKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQ ERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNP SVIDKQDKD" BASE COUNT 252 a 194 c 246 g 214 t ORIGIN 1 atggaggtgc cgccaccggc accgcggagc tttctctgta gagcattgtg cctatttccc 61 cgagtctttg ctgccgaagc tgtgactgcc gattcggaag tccttgagga gcgtcagaag 121 cggcttccct acgtcccaga gccctattac ccggaatctg gatgggaccg cctccgggag 181 ctgtttggca aagatgaaca gcagagaatt tcaaaggacc ttgctaatat ctgtaagacg 241 gcggctacag caggcatcat tggctgggtg tatgggggaa taccagcttt tattcatgct 301 aaacaacaat acattgagca gagccaggca gaaatttatc ataaccggtt tgatgctgtg 361 caatctgcac atcgtgctgc cacacgaggc ttcattcgtt atggctggcg ctggggttgg 421 agaactgcag tgtttgtgac tatattcaac acagtgaaca ctagtctgaa tgtataccga 481 aataaagatg ccttaagcca ttttgtaatt gcaggagctg tcacgggaag tctttttagg 541 ataaacgtag gcctgcgtgg cctggtggct ggtggcataa ttggagcctt gctgggcact 601 cctgtaggag gcctgctgat ggcatttcag aagtactctg gtgagactgt tcaggaaaga 661 aaacagaagg atcgaaaggc actccatgag ctaaaactgg aagagtggaa aggcagacta 721 caagttactg agcacctccc tgagaaaatt gaaagtagtt tacaggaaga tgaacctgag 781 aatgatgcta agaaaattga agcactgcta aaccttccta gaaacccttc agtaatagat 841 aaacaagaca aggactgaaa gtgctctgaa cttgagaact cactggagag ctgaagggag 901 ctgcct //