LOCUS CR533498 749 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0317D for gene DNAJB6, DnaJ (Hsp40) homolog, subfamily B, member 6; complete cds, incl. stopcodon. ACCESSION CR533498 VERSION CR533498.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 726) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 726) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0317D, ORFNo 2832 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0317D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence AL136707 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..749 /db_xref="H-InvDB:HIT000268346" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0317D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..726 /codon_start=1 /gene="DNAJB6" /db_xref="GOA:O75190" /db_xref="H-InvDB:HIT000268346.12" /db_xref="HGNC:HGNC:14888" /db_xref="InterPro:IPR001623" /db_xref="InterPro:IPR018253" /db_xref="InterPro:IPR036869" /db_xref="UniProtKB/Swiss-Prot:O75190" /protein_id="CAG38529.1" /translation="MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAER KFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFRE FFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTG FTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEV EEDGQLKSLTINGKEQLLRLDNK" BASE COUNT 229 a 131 c 195 g 194 t ORIGIN 1 atggtggatt actatgaagt cctaggcgtg cagagacatg cctcacccga ggatattaaa 61 aaggcatatc ggaaactggc actgaagtgg catccagata aaaatcctga gaataaagaa 121 gaagcagaga gaaaattcaa gcaagtagcg gaggcatatg aagtgctgtc ggatgctaag 181 aaacgggaca tctatgacaa atatggcaaa gaaggattaa atggtggagg aggaggtgga 241 agtcattttg acagtccatt tgaatttggc ttcacattcc gtaacccaga tgatgtcttc 301 agggaatttt ttggtggaag ggacccattt tcatttgact tctttgaaga cccttttgag 361 gacttctttg ggaatcgaag gggtccccga ggaagcagaa gccgagggac ggggtcgttt 421 ttctctgcgt tcagtggatt tccgtctttt ggaagtggat tttcttcttt tgatacagga 481 tttacttcat ttgggtcact aggtcacggg ggcctcactt cattctcttc cacgtcattt 541 ggtggtagtg gcatgggcaa cttcaaatcg atatcaactt caactaaaat ggttaatggc 601 agaaaaatca ctacaaagag aattgtcgag aacggtcaag aaagagtaga agttgaagaa 661 gatggccagt taaagtcctt aacaataaat ggtaaggagc agctgctgcg cttggataac 721 aagtaattca acgcacgcac ttaacagaa //