LOCUS       CR533498                 749 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0317D for
            gene DNAJB6, DnaJ (Hsp40) homolog, subfamily B, member 6; complete
            cds, incl. stopcodon.
ACCESSION   CR533498
VERSION     CR533498.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 726)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 726)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0317D, ORFNo 2832
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0317D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence AL136707
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..749
                     /db_xref="H-InvDB:HIT000268346"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0317D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..726
                     /codon_start=1
                     /gene="DNAJB6"
                     /db_xref="GOA:O75190"
                     /db_xref="H-InvDB:HIT000268346.12"
                     /db_xref="HGNC:HGNC:14888"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="UniProtKB/Swiss-Prot:O75190"
                     /protein_id="CAG38529.1"
                     /translation="MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAER
                     KFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFRE
                     FFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTG
                     FTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEV
                     EEDGQLKSLTINGKEQLLRLDNK"
BASE COUNT          229 a          131 c          195 g          194 t
ORIGIN      
        1 atggtggatt actatgaagt cctaggcgtg cagagacatg cctcacccga ggatattaaa
       61 aaggcatatc ggaaactggc actgaagtgg catccagata aaaatcctga gaataaagaa
      121 gaagcagaga gaaaattcaa gcaagtagcg gaggcatatg aagtgctgtc ggatgctaag
      181 aaacgggaca tctatgacaa atatggcaaa gaaggattaa atggtggagg aggaggtgga
      241 agtcattttg acagtccatt tgaatttggc ttcacattcc gtaacccaga tgatgtcttc
      301 agggaatttt ttggtggaag ggacccattt tcatttgact tctttgaaga cccttttgag
      361 gacttctttg ggaatcgaag gggtccccga ggaagcagaa gccgagggac ggggtcgttt
      421 ttctctgcgt tcagtggatt tccgtctttt ggaagtggat tttcttcttt tgatacagga
      481 tttacttcat ttgggtcact aggtcacggg ggcctcactt cattctcttc cacgtcattt
      541 ggtggtagtg gcatgggcaa cttcaaatcg atatcaactt caactaaaat ggttaatggc
      601 agaaaaatca ctacaaagag aattgtcgag aacggtcaag aaagagtaga agttgaagaa
      661 gatggccagt taaagtcctt aacaataaat ggtaaggagc agctgctgcg cttggataac
      721 aagtaattca acgcacgcac ttaacagaa
//