LOCUS CR533484 679 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A1017D for gene SPIN, spindlin; complete cds, incl. stopcodon. ACCESSION CR533484 VERSION CR533484.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 513) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 513) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A1017D, ORFNo 2806 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1017D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence AL136719 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..679 /db_xref="H-InvDB:HIT000268332" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A1017D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..513 /codon_start=1 /gene="SPIN" /db_xref="GOA:Q9Y657" /db_xref="H-InvDB:HIT000268332.13" /db_xref="HGNC:HGNC:11243" /db_xref="InterPro:IPR003671" /db_xref="InterPro:IPR029565" /db_xref="PDB:2NS2" /db_xref="PDB:4H75" /db_xref="PDB:4MZF" /db_xref="PDB:4MZG" /db_xref="PDB:4MZH" /db_xref="PDB:5JSG" /db_xref="PDB:5JSJ" /db_xref="PDB:5Y5W" /db_xref="PDB:6I8B" /db_xref="PDB:6I8L" /db_xref="PDB:6I8Y" /db_xref="PDB:6QPL" /db_xref="UniProtKB/Swiss-Prot:Q9Y657" /protein_id="CAG38515.1" /translation="MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSK PVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLEL NKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAP VMNTWFYITY" BASE COUNT 203 a 143 c 179 g 154 t ORIGIN 1 atgaagaccc cattcggaaa gacacctggc cagcggtcca gagctgatgc aggccatgct 61 ggagtatctg ccaacatgat gaagaagagg acatcccaca aaaaacatcg gagcagtgtg 121 ggtccgagca aacctgtttc ccagccccgg cggaacatcg taggctgcag gattcagcat 181 gggtggaaag aggggaatgg ccctgttacc cagtggaaag gaaccgttct ggaccaggtg 241 cctgtaaatc cttctttgta tcttataaaa tacgatggat ttgactgtgt ttatggacta 301 gaacttaata aagatgaaag agtttctgcg cttgaagtcc tccctgatag agttgcgaca 361 tctcgaatca gcgatgcaca cttggcagac acaatgattg gcaaagcagt ggaacatatg 421 tttgagacag aggatggttc taaagatgag tggaggggaa tggtcttagc acgtgcacct 481 gtcatgaaca catggtttta cattacctat tagaaagacc ctgtcttgta catgtaccaa 541 ctcttagatg attacaaaga aggcgacctt cgcattatgc ctgattccaa tgattcacct 601 ccagcagaaa gggaaccagg agaagttgtg gacagcctgg taggcaaaca agtggaatat 661 gccaaagaag atggctcga //