LOCUS       CR533484                 679 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A1017D for
            gene SPIN, spindlin; complete cds, incl. stopcodon.
ACCESSION   CR533484
VERSION     CR533484.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 513)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 513)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A1017D, ORFNo 2806
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1017D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence AL136719
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..679
                     /db_xref="H-InvDB:HIT000268332"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A1017D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..513
                     /codon_start=1
                     /gene="SPIN"
                     /db_xref="GOA:Q9Y657"
                     /db_xref="H-InvDB:HIT000268332.13"
                     /db_xref="HGNC:HGNC:11243"
                     /db_xref="InterPro:IPR003671"
                     /db_xref="InterPro:IPR029565"
                     /db_xref="PDB:2NS2"
                     /db_xref="PDB:4H75"
                     /db_xref="PDB:4MZF"
                     /db_xref="PDB:4MZG"
                     /db_xref="PDB:4MZH"
                     /db_xref="PDB:5JSG"
                     /db_xref="PDB:5JSJ"
                     /db_xref="PDB:5Y5W"
                     /db_xref="PDB:6I8B"
                     /db_xref="PDB:6I8L"
                     /db_xref="PDB:6I8Y"
                     /db_xref="PDB:6QPL"
                     /db_xref="UniProtKB/Swiss-Prot:Q9Y657"
                     /protein_id="CAG38515.1"
                     /translation="MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSK
                     PVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLEL
                     NKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAP
                     VMNTWFYITY"
BASE COUNT          203 a          143 c          179 g          154 t
ORIGIN      
        1 atgaagaccc cattcggaaa gacacctggc cagcggtcca gagctgatgc aggccatgct
       61 ggagtatctg ccaacatgat gaagaagagg acatcccaca aaaaacatcg gagcagtgtg
      121 ggtccgagca aacctgtttc ccagccccgg cggaacatcg taggctgcag gattcagcat
      181 gggtggaaag aggggaatgg ccctgttacc cagtggaaag gaaccgttct ggaccaggtg
      241 cctgtaaatc cttctttgta tcttataaaa tacgatggat ttgactgtgt ttatggacta
      301 gaacttaata aagatgaaag agtttctgcg cttgaagtcc tccctgatag agttgcgaca
      361 tctcgaatca gcgatgcaca cttggcagac acaatgattg gcaaagcagt ggaacatatg
      421 tttgagacag aggatggttc taaagatgag tggaggggaa tggtcttagc acgtgcacct
      481 gtcatgaaca catggtttta cattacctat tagaaagacc ctgtcttgta catgtaccaa
      541 ctcttagatg attacaaaga aggcgacctt cgcattatgc ctgattccaa tgattcacct
      601 ccagcagaaa gggaaccagg agaagttgtg gacagcctgg taggcaaaca agtggaatat
      661 gccaaagaag atggctcga
//