LOCUS CR533480 437 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0917D for gene GABARAPL1, GABA(A) receptor-associated protein like 1; complete cds, incl. stopcodon. ACCESSION CR533480 VERSION CR533480.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 354) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 354) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0917D, ORFNo 2802 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0917D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence NM_031412 (gi13899218) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..437 /db_xref="H-InvDB:HIT000268328" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0917D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..354 /codon_start=1 /gene="GABARAPL1" /db_xref="GOA:Q9H0R8" /db_xref="H-InvDB:HIT000268328.13" /db_xref="HGNC:HGNC:4068" /db_xref="InterPro:IPR004241" /db_xref="InterPro:IPR029071" /db_xref="PDB:2L8J" /db_xref="PDB:2R2Q" /db_xref="PDB:5DPT" /db_xref="PDB:5LXH" /db_xref="PDB:5LXI" /db_xref="PDB:6HOI" /db_xref="PDB:6HOL" /db_xref="UniProtKB/Swiss-Prot:Q9H0R8" /protein_id="CAG38511.1" /translation="MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDL DKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEED YFLYVAYSDESVYGK" BASE COUNT 119 a 92 c 131 g 95 t ORIGIN 1 atgaagttcc agtacaagga ggaccatccc tttgagtatc ggaaaaagga aggagaaaag 61 atccggaaga aatatccgga cagggtcccc gtgattgtag agaaggctcc aaaagccagg 121 gtgcctgatc tggacaagag gaagtaccta gtgccctctg accttactgt tggccagttc 181 tacttcttaa tccggaagag aatccacctg agacctgagg acgccttatt cttctttgtc 241 aacaacacca tccctcccac cagtgctacc atgggccaac tgtatgagga caatcatgag 301 gaagactatt ttctgtatgt ggcctacagt gatgagagtg tctatgggaa atgagtggtt 361 ggaagcccag cagatgggag cacctggact tgggggtagg ggaggggtgt gtgtgcgcga 421 catggggaaa gagggtg //