LOCUS       CR533480                 437 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A0917D for
            gene GABARAPL1, GABA(A) receptor-associated protein like 1;
            complete cds, incl. stopcodon.
ACCESSION   CR533480
VERSION     CR533480.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 354)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 354)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A0917D, ORFNo 2802
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0917D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence NM_031412 (gi13899218)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..437
                     /db_xref="H-InvDB:HIT000268328"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A0917D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..354
                     /codon_start=1
                     /gene="GABARAPL1"
                     /db_xref="GOA:Q9H0R8"
                     /db_xref="H-InvDB:HIT000268328.13"
                     /db_xref="HGNC:HGNC:4068"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="PDB:2L8J"
                     /db_xref="PDB:2R2Q"
                     /db_xref="PDB:5DPT"
                     /db_xref="PDB:5LXH"
                     /db_xref="PDB:5LXI"
                     /db_xref="PDB:6HOI"
                     /db_xref="PDB:6HOL"
                     /db_xref="UniProtKB/Swiss-Prot:Q9H0R8"
                     /protein_id="CAG38511.1"
                     /translation="MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDL
                     DKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEED
                     YFLYVAYSDESVYGK"
BASE COUNT          119 a           92 c          131 g           95 t
ORIGIN      
        1 atgaagttcc agtacaagga ggaccatccc tttgagtatc ggaaaaagga aggagaaaag
       61 atccggaaga aatatccgga cagggtcccc gtgattgtag agaaggctcc aaaagccagg
      121 gtgcctgatc tggacaagag gaagtaccta gtgccctctg accttactgt tggccagttc
      181 tacttcttaa tccggaagag aatccacctg agacctgagg acgccttatt cttctttgtc
      241 aacaacacca tccctcccac cagtgctacc atgggccaac tgtatgagga caatcatgag
      301 gaagactatt ttctgtatgt ggcctacagt gatgagagtg tctatgggaa atgagtggtt
      361 ggaagcccag cagatgggag cacctggact tgggggtagg ggaggggtgt gtgtgcgcga
      421 catggggaaa gagggtg
//