LOCUS       CR533469                 765 bp    mRNA    linear   HUM 22-JUN-2004
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0517D for
            gene RAB6C, RAB6C, member RAS oncogene family; complete cds, incl.
            stopcodon.
ACCESSION   CR533469
VERSION     CR533469.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 765)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 765)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0517D, ORFNo 2784
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0517D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence NM_032144 (gi14149798)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..765
                     /db_xref="H-InvDB:HIT000268317"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0517D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..765
                     /codon_start=1
                     /gene="RAB6C"
                     /db_xref="GOA:Q9H0N0"
                     /db_xref="H-InvDB:HIT000268317.13"
                     /db_xref="HGNC:HGNC:16525"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q9H0N0"
                     /protein_id="CAG38500.1"
                     /translation="MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQA
                     IIGIDFLSKTMYLEDGTIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQ
                     QTTKWIDDVRTERGSDVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKTG
                     YNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLP
                     QKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR"
BASE COUNT          221 a          157 c          196 g          191 t
ORIGIN      
        1 atgtccgcgg gcggagactt cgggaatccg ctgaggaaat tcaagctggt gttcctgggg
       61 gagcaaagcg ttgcaaagac atctttgatc accagattca ggtatgacag ttttgacaac
      121 acctatcagg caataattgg cattgacttt ttatcaaaaa ctatgtactt ggaggatgga
      181 acaatcgggc ttcggctgtg ggatacggcg ggtcaggaac gtctccgtag cctcattccc
      241 aggtacatcc gtgattctgc tgcagctgta gtagtttacg atatcacaaa tgttaactca
      301 ttccagcaaa ctacaaagtg gattgatgat gtcagaacag aaagaggaag tgatgttatc
      361 atcacgctag taggaaatag aacagatctt gctgacaaga ggcaagtgtc agttgaggag
      421 ggagagagga aagccaaagg gctgaatgtt acgtttattg aaactagggc aaaaactgga
      481 tacaatgtaa agcagctctt tcgacgtgta gcagcagctt tgccgggaat ggaaagcaca
      541 caggacggaa gcagagaaga catgagtgac ataaaactgg aaaagcctca ggagcaaaca
      601 gtcagcgaag ggggttgttc ctgctactct cccatgtcat cttcaaccct tcctcagaag
      661 cccccttact ctttcattga ctgcagtgtg aatattggct tgaacctttt cccttcatta
      721 ataacgtttt gcaattcatc attgctgcct gtctcgtgga ggtga
//