LOCUS CR533469 765 bp mRNA linear HUM 22-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0517D for gene RAB6C, RAB6C, member RAS oncogene family; complete cds, incl. stopcodon. ACCESSION CR533469 VERSION CR533469.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 765) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 765) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0517D, ORFNo 2784 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0517D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence NM_032144 (gi14149798) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..765 /db_xref="H-InvDB:HIT000268317" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0517D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..765 /codon_start=1 /gene="RAB6C" /db_xref="GOA:Q9H0N0" /db_xref="H-InvDB:HIT000268317.13" /db_xref="HGNC:HGNC:16525" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="UniProtKB/Swiss-Prot:Q9H0N0" /protein_id="CAG38500.1" /translation="MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQA IIGIDFLSKTMYLEDGTIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQ QTTKWIDDVRTERGSDVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKTG YNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLP QKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR" BASE COUNT 221 a 157 c 196 g 191 t ORIGIN 1 atgtccgcgg gcggagactt cgggaatccg ctgaggaaat tcaagctggt gttcctgggg 61 gagcaaagcg ttgcaaagac atctttgatc accagattca ggtatgacag ttttgacaac 121 acctatcagg caataattgg cattgacttt ttatcaaaaa ctatgtactt ggaggatgga 181 acaatcgggc ttcggctgtg ggatacggcg ggtcaggaac gtctccgtag cctcattccc 241 aggtacatcc gtgattctgc tgcagctgta gtagtttacg atatcacaaa tgttaactca 301 ttccagcaaa ctacaaagtg gattgatgat gtcagaacag aaagaggaag tgatgttatc 361 atcacgctag taggaaatag aacagatctt gctgacaaga ggcaagtgtc agttgaggag 421 ggagagagga aagccaaagg gctgaatgtt acgtttattg aaactagggc aaaaactgga 481 tacaatgtaa agcagctctt tcgacgtgta gcagcagctt tgccgggaat ggaaagcaca 541 caggacggaa gcagagaaga catgagtgac ataaaactgg aaaagcctca ggagcaaaca 601 gtcagcgaag ggggttgttc ctgctactct cccatgtcat cttcaaccct tcctcagaag 661 cccccttact ctttcattga ctgcagtgtg aatattggct tgaacctttt cccttcatta 721 ataacgtttt gcaattcatc attgctgcct gtctcgtgga ggtga //