LOCUS CR533464 823 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0317D for gene UNC50, unc-50 homolog (C. elegans); complete cds, incl. stopcodon. ACCESSION CR533464 VERSION CR533464.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 780) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 780) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0317D, ORFNo 2775 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0317D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full ORF clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). After the stop codon 3' UTR sequence is present in front of the 3' att site (ACCCAGCTTTCTT). Compared to the reference sequence AY017215 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..823 /db_xref="H-InvDB:HIT000268312" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0317D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..780 /codon_start=1 /gene="UNC50" /db_xref="GOA:Q53HI1" /db_xref="H-InvDB:HIT000268312.11" /db_xref="HGNC:HGNC:16046" /db_xref="InterPro:IPR007881" /db_xref="UniProtKB/Swiss-Prot:Q53HI1" /protein_id="CAG38495.1" /translation="MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQM DFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFV LDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVH LNAFYPLLVILHLIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPF LKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK" BASE COUNT 208 a 164 c 181 g 270 t ORIGIN 1 atgttaccga gtacttcagt gaattcctta gtgcagggga acggagtctt gaattccagg 61 gatgcggcaa gacacacagc cggagcgaaa cgctacaaat atctgagaag gcttttccgc 121 tttcggcaaa tggactttga atttgctgcc tggcagatgc tctacctgtt cacatcccca 181 cagagagttt acagaaattt tcattatcga aaacagacga aggaccagtg ggccagagat 241 gaccctgctt tcttggtcct gttaagtatc tggctctgtg tgtccactat aggatttggc 301 tttgtgctgg acatgggatt ctttgagaca ataaagcttc tcctttgggt tgtactcata 361 gattgtgtag gcgttggtct tctgatagca actttaatgt ggttcatctc taacaagtat 421 ttagtgaaac gacagagcag agactatgat gtggaatggg gctatgcttt tgatgtgcat 481 ctcaatgctt tttatccact cctggtcatt ttgcatctta tccagctttt tttcatcaac 541 catgttatcc tgacagacac atttattgga tatttagttg gaaatacctt atggttggtt 601 gcagttggct attatatcta tgtaactttc ctgggataca gtgcattgcc atttttgaaa 661 aatacagtaa ttcttctgta tccatttgca cctctgattc tgctctacgg gctttccctg 721 gcactgggat ggaacttcac ccatactctc tgttctttct ataagtacag agtgaaataa 781 aaagtgagaa gaagattcaa tcgtaactgt gtctacagta ttg //