LOCUS       CR533464                 823 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0317D for
            gene UNC50, unc-50 homolog (C. elegans); complete cds, incl.
            stopcodon.
ACCESSION   CR533464
VERSION     CR533464.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 780)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 780)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (21-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0317D, ORFNo 2775
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0317D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            After the stop codon 3' UTR sequence is present in front of the
            3' att site (ACCCAGCTTTCTT).
            Compared to the reference sequence AY017215
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..823
                     /db_xref="H-InvDB:HIT000268312"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0317D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..780
                     /codon_start=1
                     /gene="UNC50"
                     /db_xref="GOA:Q53HI1"
                     /db_xref="H-InvDB:HIT000268312.11"
                     /db_xref="HGNC:HGNC:16046"
                     /db_xref="InterPro:IPR007881"
                     /db_xref="UniProtKB/Swiss-Prot:Q53HI1"
                     /protein_id="CAG38495.1"
                     /translation="MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQM
                     DFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFV
                     LDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVH
                     LNAFYPLLVILHLIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPF
                     LKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK"
BASE COUNT          208 a          164 c          181 g          270 t
ORIGIN      
        1 atgttaccga gtacttcagt gaattcctta gtgcagggga acggagtctt gaattccagg
       61 gatgcggcaa gacacacagc cggagcgaaa cgctacaaat atctgagaag gcttttccgc
      121 tttcggcaaa tggactttga atttgctgcc tggcagatgc tctacctgtt cacatcccca
      181 cagagagttt acagaaattt tcattatcga aaacagacga aggaccagtg ggccagagat
      241 gaccctgctt tcttggtcct gttaagtatc tggctctgtg tgtccactat aggatttggc
      301 tttgtgctgg acatgggatt ctttgagaca ataaagcttc tcctttgggt tgtactcata
      361 gattgtgtag gcgttggtct tctgatagca actttaatgt ggttcatctc taacaagtat
      421 ttagtgaaac gacagagcag agactatgat gtggaatggg gctatgcttt tgatgtgcat
      481 ctcaatgctt tttatccact cctggtcatt ttgcatctta tccagctttt tttcatcaac
      541 catgttatcc tgacagacac atttattgga tatttagttg gaaatacctt atggttggtt
      601 gcagttggct attatatcta tgtaactttc ctgggataca gtgcattgcc atttttgaaa
      661 aatacagtaa ttcttctgta tccatttgca cctctgattc tgctctacgg gctttccctg
      721 gcactgggat ggaacttcac ccatactctc tgttctttct ataagtacag agtgaaataa
      781 aaagtgagaa gaagattcaa tcgtaactgt gtctacagta ttg
//